KEGG   Allochromatium vinosum: Alvin_1501Help
Entry
Alvin_1501        CDS       T01168                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
Organism
alv  Allochromatium vinosum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1737242..1740085)
Genome map
AA seq 947 aa AA seqDB search
MTSHPHPTDERHEAAPAHSTTPVHDEPARRLLSVLSDFVRESHLPEPREGLTLDTRLESD
LGLDSLSRSELIARIERGLNIQLPDTALLADTPRELLARMRGTPDTQAGGSQGVTLAAPT
GAGLEHPSGARTLLDVLAWHRDRQGERVHLTYYDGDDRPHPLTHAALAEGAERVAARLHA
AGLKSGGTVAIMLPTGLDYFFAFFGVLIAGGVPVPIYPPARPQQLEDHLRRHARLLDNAG
VCVLITVSEARHVARLLSAQVPSLHEILTLETPDETAPLSRADWAAPNAGDLAFLQYTSG
STGDPKGVMLTHADLLANIRAMGEAIAIAPDDVFVSWLPLYHDMGLIGAWLGSLYFGVPL
IVMSPLAFLARPRRWLQAISAHRGTLSAAPNFAYELCLTRLSDSQLEGLDLRSWRRAFNG
AEPVSAETLHRFAERFAPCGLRPEALAPVYGLAEAAVGLAFPPVERGPRIDCIDRARFAG
SGYALPVACDDPDAMAVVACGRPLPGYRVRVVDESGRERPERHEGLLQFQGPSATQGYYR
HPEATARLIRDGWHETGDRAYLAGGDIHLTGRVKDLIIRGGRNLYPYEVEQALGELTGIR
RGCVVAFAARDARQGSERLVIVAESKERDPERRAALAQRARERATEVLGLPPDEIVLAPP
RAVLKTSSGKLRRGDTRERYLAGRLFDTPPAPVWQLARVGARAVLARLRTWGVRLPETLY
AGYAWGVFTLLAPWVWGGVMLSPRPAWRWSLARGGVRLLRRLMGVRLRMTGREHLPPAGR
SLVLVANHQSYLDALALIEAVPRPMRFVAKRELNANPLAGRFLERLGTLFVERFDLQQSH
REGERLQTALRDGASLAFFPEGTFRERPGLLPFRMGAFVAAAEAGVPILPVTIRGTRAVM
PGDRFRPRPGTIEVVIAAPILPQGTDWEAASLLRDAARAVIAARDAA
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagccacccacatccaaccgatgaacgccatgaggcggcgccggcccactcgacc
acacccgtccacgatgagcctgcccgccgacttctgagtgttctgagcgactttgtgcgc
gaatcgcatctgcccgagccgcgcgagggcctgacgctcgacacccggctcgaatccgat
ctcggactcgacagcctgagccgctcggaactgatcgcgcgtatcgagcgcggcctgaac
atccagttgcccgatacggcactgctggccgacacgccgcgcgagctgctggcgcggatg
cgcgggacgccggacacccaggccggcgggagtcagggcgtcacgctcgccgcgccgaca
ggtgcagggctggagcatccatccggcgcacggacactgctcgacgtgctcgcctggcat
cgcgaccgccagggcgagcgtgtccatctgacctattacgacggcgacgaccggccccat
ccgctcacccatgccgctttggccgagggcgctgagcgcgtcgccgcccgactgcatgcg
gcgggactcaagagcggcgggacggtagcgatcatgctgccgaccggcctggattatttc
ttcgccttcttcggcgtgctgatcgcgggcggcgtacccgtacccatctatccgccggca
cggccccagcaactcgaagatcatctgcgccgccatgcgcgactgctcgacaatgccggc
gtgtgcgtgctgatcacggtgtccgaggcgcgtcacgtcgcccggctgttgagtgcccag
gtgccgtcactgcacgagatcctgacgctggagacgccggacgagacagcccccttgagc
cgcgccgactgggccgccccaaacgccggcgatctggcctttctgcaatacacctccggc
agcacgggcgatcccaagggcgtgatgctcacccatgccgacctgctcgccaacatccgc
gccatgggcgaggccatcgccatcgcgcccgacgatgtcttcgtcagctggctgccgctc
tatcacgacatgggactgatcggcgcctggctggggagcctctatttcggcgtgccgctg
atcgtcatgtcgccactggcctttctcgcccgtcccaggcgctggctccaggcgatcagc
gcgcatcgcggcacgctgtcggcggcgcccaacttcgcctatgaactctgtctgacgcgg
ctctccgacagccagctggaggggctggatctgcgttcctggcgccgggccttcaacggc
gccgagccggtcagcgccgagaccctgcatcgattcgccgagcgttttgcgccctgcggg
ttgcggcctgaggcgctggctccggtctatgggctggccgaggcggcggtcggtctggcc
tttccgccggtggaacgcgggccgcgcatcgactgtatcgaccgcgcgcgtttcgccggc
tcgggctatgccctgccagtggcctgcgacgatccggacgcgatggcggtggtcgcctgc
gggcgtccgctgccgggctatcgggtgcgggtggtcgacgagtcgggccgggagcgaccc
gagcggcacgagggcctgctgcaattccagggtccatcggcgacccagggttactatcgc
cacccggaggccacggcgcgcctgatccgcgacggctggcacgagaccggcgatcgcgcc
tatctggctggcggcgacatccatctcaccggacgggtgaaggatctgatcatccgcggc
gggcgcaatctctatccctacgaggtcgagcaggcactcggcgagctgacgggcatccgg
cgcggttgcgtggtcgcgttcgccgcccgcgatgcgcgtcagggcagcgaacggctggtg
atcgtggccgagagcaaggagcgcgatcccgagcggcgggcggccctggctcagcgtgcg
cgtgagcgggccaccgaggtgctgggtctcccacccgacgagatcgtgctggccccgccg
cgcgccgtgctcaagacctccagcggcaagctgcgccggggtgatacgcgcgaacgctat
ctggccgggcggctgttcgatacaccgccggcacctgtctggcagttggcgcgggtcggc
gcgcgggcggttctggcgcgactgcgtacctggggcgtccgactgcctgaaaccctctat
gccggctatgcctggggcgtattcactctgctggcgccctgggtatggggcggcgtcatg
ctgagcccgcgtccggcctggcgctggtcgctggcgcgtggcggcgtccggctcttgcgt
cgactcatgggtgtgcgtctgcgtatgacggggcgggagcatctgccacccgctgggcga
agcctagtactggtcgccaaccatcagagttatctcgatgccctggccctgatcgaggcc
gttccgcgtccgatgcgcttcgtcgccaagcgcgaactgaacgccaatccgctggccggg
cgctttctcgaacgcctgggaacgctgttcgtcgagcggttcgatctccagcagagtcat
cgcgagggcgagcgcttgcagacggcgttgcgtgatggggcgagtctggccttcttcccc
gagggcaccttccgcgagcggccgggtctgctacccttccgtatgggggccttcgtggcg
gcggccgaggcgggtgtgccgattctgccggtcacgatccgggggacgcgcgccgtcatg
ccgggcgaccgtttccgcccgcgtccggggacgatcgaagtcgtcatcgcggcgccgatc
cttccccaaggaacggactgggaggcagccagcctgctgcgcgatgccgcccgcgccgtc
atcgccgctcgggacgcggcctga

DBGET integrated database retrieval system