Anaplasma marginale St. Maries: AM1083 Help Entry AM1083            CDS       T00216                                  Symbol grxC1 Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism ama  Anaplasma marginale St. Maries Brite KEGG Orthology (KO) [BR:ama00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ama03110]     AM1083 (grxC1) Chaperones and folding catalysts [BR:ama03110]  Protein folding catalysts   Protein disulfide isomerase    AM1083 (grxC1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 Thioredoxin_2 DUF99 Motif Other DBs NCBI-ProteinID:  AAV86942 LinkDB All DBs Position 979550..979792 Genome browser AA seq 80 aa AA seqDB search MREVLIYTKVPCPYCTRAKALFNKKNVPFKEIDITDNPEAMREMVERSGRRTVPQIFIDG KSIGGCDDLYALYESGELEL NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcgggaggtcctcatatatacaaaggtcccctgcccctattgtactagggcaaaggct ttgttcaacaaaaaaaatgtaccctttaaggagattgacatcaccgataacccggaggct atgcgtgagatggtagagcgctcggggaggaggactgtgccgcagatttttattgacggc aagagcataggcggttgtgatgatctatacgccctgtacgaatccggggagttggaactc tag

DBGET integrated database retrieval system