KEGG   Alteromonas mediterranea DE1: amad1_15090Help
Entry
amad1_15090       CDS       T02340                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    amad1_15090
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    amad1_15090
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    amad1_15090
Enzymes [BR:amaa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     amad1_15090
Peptidoglycan biosynthesis and degradation proteins [BR:amaa01011]
 Precursor biosynthesis
  Amino acid ligase
   amad1_15090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3401007..3401975)
Genome map
AA seq 322 aa AA seqDB search
MFKPSVSTHSPEKYGKVAVLLGGDSAEREVSLNSGNAVLNALLRQGVNAFAFDPAERPLN
DLLSLDVDRALIMLHGRGGEDGAMQGALQFLKIPYTGSRVLGSALAMDKIHTKQVWQSLG
LPTAKYEIADKRHFEAGKCSAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLETAIQDAF
KYDNQVLLEQYIDGPEFTVSVIQGQALPSIRMSTPHTFYDYAAKYQDNTTEYYCPSGLSE
EQEAQLAKLASRAFDAISGSGWGRIDVMQDNQRQFYLLEANTVPGMTEKSLVPKAAKVAG
LTFDELVLSILSTSFDDVANKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccttcagtaagtacacactcacctgaaaagtatgggaaagtagccgtactt
ttaggcggtgactcggccgagcgtgaagtatcgctaaattcgggaaatgcggtgctaaac
gcactgttaagacaaggggtaaatgcatttgcctttgaccccgcagagcgcccgcttaac
gatttgctgtcgctagatgttgatagagctctcattatgcttcacggtcgcggcggtgaa
gatggcgctatgcagggggctcttcagtttttaaaaataccctacacgggaagccgagtt
ttaggctcagcgctggcgatggacaaaattcatactaagcaagtgtggcaaagtttaggt
ttacccactgcaaaatatgaaattgctgacaaaaggcactttgaagctggtaagtgcagc
gctataatggataaattggggaatgaagtcatggtaaaaccggccagagaagggtcgagt
attggcatggcgagagtgacaagcgctaaacagctcgaaactgccattcaggacgctttc
aaatacgataatcaagtcctgttagagcagtacatagacggccctgaatttactgtttct
gtgatacaggggcaggcgttgccgtctattcgcatgtctactccacatacattctatgat
tatgctgcgaaatatcaggataatacaacagaatactattgcccaagcggtttgtctgaa
gagcaagaagcacagcttgcaaagttagcttctcgtgcgtttgatgctatttctggcagc
ggttggggcagaattgatgttatgcaggacaatcaaaggcagttttatttgctagaggca
aatacagtgcctggcatgacagaaaaaagtttggtgcctaaagcggccaaagttgcaggc
ttaacgtttgacgagttggtgttgagtattctttcgaccagctttgatgatgttgcaaat
aaggcgtag

DBGET integrated database retrieval system