KEGG   Alteromonas mediterranea UM7: I635_15300Help
Entry
I635_15300        CDS       T02724                                 

Definition
(GenBank) glutathione S-transferase domain-containing protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
amai  Alteromonas mediterranea UM7
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amai00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    I635_15300
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    I635_15300
   00982 Drug metabolism - cytochrome P450
    I635_15300
   00983 Drug metabolism - other enzymes
    I635_15300
 Human Diseases
  Cancers
   05200 Pathways in cancer
    I635_15300
   05204 Chemical carcinogenesis
    I635_15300
   05225 Hepatocellular carcinoma
    I635_15300
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    I635_15300
  Drug resistance
   01524 Platinum drug resistance
    I635_15300
Enzymes [BR:amai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     I635_15300
Transporters [BR:amai02000]
 Other Transporters
  Pores ion channels [TC:1]
   I635_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3438968..3439600)
Genome map
AA seq 210 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKLIDLKQGQHLSDEYKAVSPSAKIPVLATPEG
TLSESAAIVTYLAERHGMQEFIPEPSSFSRAKYEEMMLFLTSELEQPVWNLAKHTFALPE
SQRLEEMHGVSAWEFQRALRVFASMLGGNEFVCGNMFTMADVIAGHILAWAKGSKLAIDF
QNISDYAQRVLTREAYERAWRGEMSHLPAQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttacggttaccctaaaacccgctcggttcgtgtagcgtgggcgctggaa
gaaattggtttaccttacgaatacaaactaatcgacttgaaacaaggtcagcatttgtct
gatgaatataaagcagtaagcccatcggcgaaaataccggtattggcaacccccgagggc
acactgtctgagtcagctgccattgtcacttacttggctgagcgccacggtatgcaagaa
tttattcccgagcctagcagtttctcgcgggctaagtacgaagagatgatgctatttctc
accagtgagctagaacagccggtttggaatttagccaagcacacgtttgctttacccgaa
tcgcaaagactggaggaaatgcacggcgttagtgcgtgggaatttcagcgtgcgctcagg
gtgtttgcttctatgcttggcggtaacgaatttgtttgcggtaacatgtttactatggcc
gacgttattgcagggcatattttagcgtgggctaagggcagtaagttagcaatcgacttt
caaaatataagtgactacgcacaacgtgtactgacacgagaagcctatgagcgtgcgtgg
cgcggcgaaatgtcgcacttacccgctcaataa

DBGET integrated database retrieval system