KEGG   Alteromonas mediterranea U4: I607_14635Help
Entry
I607_14635        CDS       T02720                                 

Definition
(GenBank) superoxide dismutase, Cu-Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
amal  Alteromonas mediterranea U4
Brite
Enzymes [BR:amal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I607_14635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3284261..3284806
Genome map
AA seq 181 aa AA seqDB search
MKKRLLSTLAGSISLILSAGSLAGHHQHEGKEVVMNNLKTNQSMGTVKVSSYDDDGVVFT
PNLSGLTPGIHGFHVHQNGDCSTAMKDGKKILGGAAGGHFDPEDTNKHRAPWSEKGHEGD
LPVLYVDENGKATQPIFAPELELEDIEGRALMIHAGGDNYSDSPKKLGGGGERVACGLIG
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtttattatctaccctagcagggtctatctcactgattctaagtgcaggc
agcttagcaggtcatcaccaacacgaaggaaaagaggtggtgatgaataaccttaaaacc
aaccagagcatgggtactgtaaaggtaagcagctacgacgatgatggtgtggtttttacg
cctaacctttccggtttaacgccgggtatacacgggtttcacgttcatcaaaatggtgat
tgctcaacggctatgaaagacggtaaaaaaatacttggtggtgctgccggcggacacttc
gacccagaagataccaataaacacagagctccatggtctgagaaagggcacgaaggcgat
cttcccgtgctgtatgttgatgaaaacggaaaagccacgcagcctattttcgccccagag
ctagagcttgaagatattgaaggtcgtgcacttatgattcacgcaggcggcgacaactac
tcagactcccctaaaaaactaggtggtggcggcgaacgcgttgcttgtggcctaatcggt
aaatag

DBGET integrated database retrieval system