KEGG   Alteromonas mediterranea U4: I607_16425Help
Entry
I607_16425        CDS       T02720                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amal  Alteromonas mediterranea U4
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    I607_16425
  Energy metabolism
   00680 Methane metabolism
    I607_16425
Enzymes [BR:amal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     I607_16425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3700188..3702809
Genome map
AA seq 873 aa AA seqDB search
MQTHYDAELKDTVRYLGKTLGETIKNQLGQEWLDRIEKIRKGGRASYQGDATCSEELKET
FKTMSDSDLLTVGRAFAQFLNLGNIAEQEYNAAMNVDASIDALFKHLDKAELTADKVQDA
VAKLNIDLVLTAHPTEVTRRTLIHKHKELADCLQAVHQESLSDVERKKVETRIADLIAQA
WHTEEIRSVRPTPVDEARWGFSVIENSLWEAVPDFMRELDGRLNEDYDVSLPLDSSPVQF
SSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFAIDLDRLQVELSMYDCNEELRDKVGD
ANEPYRALLRPLVNKFIATRDGIADYLAGKNPDTSNWIESDDELIEPLMLCYQSLIDCGM
QVVANGLLLDTIRRARVFGIHLLRLDVRQDSERHADVFSELTRYLGLGDYAQWSEADKQA
FLLRELGSKRPLFPAQWDASDDVKEVLDTCKVIAKHSKHGFGIYIISMASEPSDVMAVQL
LLQESGVDWPMPVAPLFETLDDLNNSPDVMRKLLSIDWYRGYVKGRQFVMIGYSDSAKDA
GALAAGWAQYQSQEALVAIAEEFDVSLTLFHGRGGTIGRGGLPAHAAIYSQPPGSLEGGF
RVTEQGETIRYKFGMPKLAKRSLGIYASAIIEAMLFPPPAPKEEWRELITTMAAQGRDNY
RATVRHDEEFVPYFRVATPEQELGKLPLGSRPAKRKPQGGIESLRAIPWIFAWAQTRLVL
PSWLGVMRAIDSVKTPENEKVVNEMFSEWPFYRSRLSMLDMVFHKADPRISEAYDERLVP
KELKHFGEALRSELKESISSLLAITGDDDIMKNDPQGKESMEIRAGYLQPLHYLQIELLD
RIRKAGDDAQNTSLERAMMVTIAGIAIGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacactacgatgctgaactgaaagataccgttcgataccttggtaaaaccctt
ggtgaaacaatcaaaaatcaattaggtcaggagtggctagaccggattgaaaagattcga
aaaggcggccgagcttcttatcagggagacgctacttgtagcgaagaactgaaagaaact
ttcaaaacaatgtctgacagcgatttgcttactgttggtcgtgccttcgcacaattcttg
aacctaggtaatattgccgagcaagaatacaacgcggcaatgaatgttgatgcatctatt
gatgcccttttcaaacacctagataaagcagaactaactgctgacaaagtacaagacgcc
gttgcaaaactaaacatcgatcttgtattaaccgcgcaccctactgaggttacgcgccgt
acacttattcataaacacaaagagctagcggattgcctgcaggctgtgcatcaagaatcg
ttaagtgatgttgagcgtaaaaaggtagaaacacgcattgctgaccttattgctcaagct
tggcacactgaagaaattcgttccgttcgcccgacccctgttgatgaagcgcgttggggc
ttctcggtcattgaaaactcattgtgggaagcggtacctgacttcatgcgcgagctagat
ggccgcttaaacgaagactacgacgtatcactaccgctagactcgtcaccagtacaattt
agctcttggatgggtggagacagagacggcaacccatttgttacttcaaaagtaactgag
caagtactgctgcttgctagaaagcgcgcggctaagcttttcgctatcgaccttgatcgt
ttgcaagtagaactttcaatgtacgattgcaacgaagaactacgtgacaaagtaggcgat
gcaaacgaaccgtaccgcgccctacttcgcccgctggtaaacaagtttattgcgactcgc
gatggcattgccgactacttggccggcaagaatccagacacgtctaactggattgaaagc
gacgacgagcttatcgagccgctaatgctttgctaccagtcattaatcgactgcggtatg
caagtagtggcaaacggccttctactagatactatccgtcgtgctcgtgtattcggtatt
caccttcttcgccttgacgtacgtcaagattctgagcgtcacgccgacgtatttagtgag
ctaactcgctacctaggtttaggcgactacgcccagtggagcgaagccgacaagcaagcg
ttcttattacgtgagcttggctcgaaacgtccgttattcccagcgcaatgggatgcatct
gacgatgtaaaagaagtgctagatacctgtaaggtgattgcgaaacacagcaagcacggc
ttcggtatttacattatctctatggcgagtgagccatcggatgtcatggcggttcagctg
cttcttcaagaaagcggtgtagactggccgatgccggtagcaccactatttgaaacgctt
gacgatttgaacaactcaccagatgtaatgcgcaaactcctgtctatcgactggtatcgc
ggttacgtgaagggccgtcagttcgttatgatcggttactctgattcagcgaaagatgca
ggcgcattggctgctggctgggcacagtatcagtcgcaagaagcattggttgccattgca
gaagaattcgacgtaagcctaaccctgttccacggacgtggcggtacgattggtcgtggt
ggattgccagcacatgcggcaatttactcacagcctcctggctcactagaaggcggtttc
cgcgtaacagaacagggcgaaactattcgctataagttcggtatgccaaaactggctaaa
cgcagcctaggtatttacgccagcgccattattgaagccatgttgttcccacctccggca
ccaaaagaagagtggcgtgagcttattaccaccatggcagcgcaaggtcgtgataactac
cgtgcaactgtacgtcacgatgaagagtttgtaccttacttccgcgtggctactccagag
caagagctaggtaaactacctctaggcagccgccctgctaagcgtaaaccacaaggcgga
attgagagcttacgtgctatcccatggatcttcgcttgggcacagacacgtttagtgctg
ccaagctggttgggcgttatgcgcgctattgatagcgtgaagactcctgagaacgagaaa
gtggttaacgagatgttcagcgaatggccgttctatcgttcacgcctttctatgttagac
atggtgttccacaaagctgacccacgcattagcgaagcttatgatgagcgcttggtaccc
aaagaacttaaacactttggtgaagcattgcgtagcgagcttaaagaaagcatctcttca
ctgctggctatcacaggcgatgacgacattatgaagaacgacccgcagggtaaagaatcg
atggagatccgcgcaggataccttcagccacttcattaccttcaaatcgagcttcttgat
cgtattcgtaaagccggtgatgacgcacaaaacaccagcctagagcgcgccatgatggta
accattgccggtattgctatcgggatgcgtaacacgggttaa

DBGET integrated database retrieval system