KEGG   Alteromonas mediterranea U8: I634_14630Help
Entry
I634_14630        CDS       T02722                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
amao  Alteromonas mediterranea U8
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:amao00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    I634_14630
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    I634_14630
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    I634_14630
Enzymes [BR:amao01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     I634_14630
Peptidoglycan biosynthesis and degradation proteins [BR:amao01011]
 Precursor biosynthesis
  Amino acid ligase
   I634_14630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3335341..3336309)
Genome map
AA seq 322 aa AA seqDB search
MFKPSVSTHSPEKYGKVAVLLGGDSAEREVSLNSGNAVLNALLRQGVNAFAFDPAERPLN
DLLSLDVDRALIMLHGRGGEDGAMQGALQFLKIPYTGSRVLGSALAMDKIHTKQVWQSLG
LPTAKYEIADKRHFEAGKCSAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLETAIQDAF
KYDNQVLLEQYIDGPEFTVSVIQGQALPSIRMSTPHTFYDYAAKYQDNTTEYYCPSGLSE
EQEAQLAKLASRAFDAISGSGWGRIDVMQDNQRQFYLLEANTVPGMTEKSLVPKAAKVAG
LTFDELVLSILSTSFDDVANKA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaccttcagtaagtacacactcacctgaaaagtatgggaaagtagctgtactt
ttaggtggtgactcggccgagcgtgaagtatcgctaaattcggggaatgcggtgctaaac
gcactgttaagacaaggggtaaatgcatttgcctttgaccccgcagagcgcccacttaac
gatttgctgtcgctagatgttgatagagccctcattatgcttcacggtcgcggcggtgaa
gatggcgctatgcagggggctcttcagtttttaaaaataccctacacgggaagccgagtt
ttaggctcagcgctggcgatggacaaaattcatactaagcaagtgtggcaaagtttaggt
ttacccactgcaaaatatgaaattgctgataaaaggcactttgaagctggtaagtgcagc
gctataatggataaattagggaatgaagtcatggtaaaaccggccagagaagggtcgagt
attggcatggcgagagtgacaagcgctaaacagctcgaaactgccattcaggacgctttc
aaatacgataatcaagtcctgttggagcagtacatagacggccctgaatttactgtttct
gtgatacaggggcaggcgttgccgtctattcgcatgtctactccacatacattctatgat
tatgctgcgaaatatcaggataatacaacagaatactattgcccaagcggtttgtctgaa
gagcaagaagcacagcttgcaaagttagcttctcgtgcgtttgatgctatttctggcagc
ggttggggcagaattgatgttatgcaggacaatcaaaggcagttttatttgctagaggca
aatacagtgcctggcatgacagaaaaaagtttggtgcctaaagcggccaaagttgcaggc
ttaacgtttgacgagttggtgttgagtattctttcgaccagctttgatgatgttgcaaat
aaggcgtag

DBGET integrated database retrieval system