KEGG   Amycolatopsis mediterranei U32: AMED_0192Help
Entry
AMED_0192         CDS       T01269                                 

Definition
(RefSeq) aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_0192
   00650 Butanoate metabolism
    AMED_0192
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_0192
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_0192
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMED_0192
Amino acid related enzymes [BR:amd01007]
 Aminotransferase (transaminase)
  Class III
   AMED_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(202573..203865)
Genome map
AA seq 430 aa AA seqDB search
MTDELLARHRAVMPSWMSLLYEEPIEIVHAHDRRMTDSQGRTYLDFFAGVLTNSMGYDVA
EIGDAVRKQLDTGILHTSTLYLIRSQVELAERIAKLSNIPDAKVFFTNSGSEANDTALML
ATQYRRSNQVLAMRNSYHGRSFATVAITGNRGWSASSLSPVKVSYVHGGYRYRSPFRTMS
DADYIDACVADLVDVLDTATAGDVACLIAEPIQGVGGFSLPPDGLFRAMKEVLDEYGVLF
ISDEVQTGWGRTGEHFWGIEAHGVTPDMMTFAKGLGNGLAVGGVVARGDVLDCFQAQSFS
TFGGNPVSMAGATAVLDYIKDHDLQANCAARGAQLLSGLRAAESPIVAEVRGKGLMIGVE
LIKPGTTEPFVAAAARMLEETKKRGLLIGKGGLHGNVLRLGPPMTLTAEEAQEGLDILVD
ALAATHAALS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgagctgctcgcccggcaccgcgctgtcatgccgtcctggatgtcgctgctc
tacgaagagccgatcgagatcgtgcacgcgcacgaccgccggatgaccgactcccagggg
cgcacgtacctggacttcttcgcgggggtgctgaccaactcgatgggctacgacgtcgcc
gagatcggcgacgcggtccgcaagcagctcgacacgggcatcctccacacgtcgacgctc
tacctgatccggtcccaggtcgagctggccgagcggatcgccaagttgtcgaacatcccg
gacgccaaggtgttcttcacgaattcgggcagcgaggccaacgacacggcgctgatgctg
gcgacgcagtaccgccgcagcaaccaggtgctggcgatgagaaattcgtaccacgggcgc
tcgttcgccacggtcgcgatcaccggcaaccgcggctggtcggcatcgtccctcagcccg
gtgaaggtcagctacgtccacggcggctaccgctatcgcagcccgttccgcaccatgtcc
gacgcggactacatcgacgcgtgcgtcgcggacctggtggacgtcctggacacggcgacg
gcgggcgacgtggcgtgcttgatcgccgagccgatccagggggtgggcggcttcagcctg
ccgccggacgggctgttccgggcgatgaaggaggtcctggacgagtacggggtgctgttc
atctcggacgaggtccagacgggctggggccgcacgggcgagcacttctggggcatcgag
gcgcacggcgtgaccccggacatgatgacgttcgccaagggcctgggcaacggcctggcg
gtcggaggcgtggtggcccgaggcgacgtgctcgactgtttccaggcccagtcgttctcg
acgttcggcggcaacccggtctcgatggccggcgcaacagcggtcctggactacatcaag
gaccacgacctgcaggccaattgcgcggcccggggagctcagctgctgtcgggcctgcgg
gcggcggagtcgccgatcgtggcagaggtccgcggcaaggggctgatgatcggggtagag
ctgatcaagccagggaccaccgagccgttcgtggccgcggcggcgaggatgctggaggag
acgaagaagcgcgggttgttgatcggaaagggcggcctgcacggcaacgtgctgcgcctg
ggccccccgatgacgctgacagcggaggaagcccaggagggtttggacatcctggtcgac
gcactggcggcaacgcacgcagcgctgagctga

DBGET integrated database retrieval system