KEGG   Amycolatopsis mediterranei U32: AMED_0927Help
Entry
AMED_0927         CDS       T01269                                 

Gene name
glpA
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
amd00564  Glycerophospholipid metabolism
amd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMED_0927 (glpA)
Enzymes [BR:amd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMED_0927 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N GIDA YdjC Pyr_redox HI0933_like
Motif
Other DBs
NCBI-GeneID: 9435144
NCBI-ProteinID: YP_003763148
UniProt: A0A0H3CZR9
LinkDB All DBs
Position
987389..989122
Genome map
AA seq 577 aa AA seqDB search
MAQHAAETNPARLGPVKREETWQRLGKETFDLVVIGGGVVGAGTALDAATRGLRVALVEA
RDLASGTSSRSSKLFHGGLRYLEQLEFGLVREALRERELMLTTIAPHLVKPVSFLYPLTH
RVWERPYTAAGLLMYDTMGGARSVPGQKHLTRAGALRMVPALKRSALIGGIRYYDAQSDD
ARHTMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDVEDGRETEISAAAVINCTG
VWTDELQRLSGGRGRFRVRASKGVHIVVPRDRIVSESGMILRTEKSVLFVIPWRNHWIVG
TTDTDWELDLAHPAATKHDIDYILEHVNTVLATPLTHDDIEGVYAGLRPLLAGESEETSK
LSREHAVARVAPGLVAIAGGKYTTYRVMAADAVDAAAVDLPGRSQPSITDKVPLLGADGY
HALVNQADHLAAEHGLHPYRVRHLLDRYGSLVHEVLASAEGRPELLKPIEHAPDYLGVEV
VYAASHEGALHLEDVLARRTRISIEYAHRGVDCAEQVAALVGEVLGWSPETVKHEIEVYR
ARVEAERESQSQPSDEAADALRSAAPEARAGIVEPVS
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagcacgcagcggagacgaacccggctcgactgggtccggtcaagcgggaagag
acttggcagcggctcggcaaggagacgttcgacctcgtcgtcatcggcggcggcgtggtc
ggggcgggcacggcgctggacgccgcgacgcgcggcctgcgggtcgcgctcgtcgaggcc
cgcgacctcgcgtccgggacgtcgagccggtcgagcaagctcttccacggcggcctgcgg
tacctggagcagctcgagttcgggctggtcagggaggcgctgcgcgagcgtgagctgatg
ctgacgaccatcgcgccccacctggtgaagccggtcagcttcctgtacccgctgacgcac
cgcgtgtgggaacgcccgtacaccgcggcgggcctgctgatgtacgacacgatgggcggc
gcccgcagcgtcccggggcagaagcacctgacccgcgcgggcgcgctgcggatggtgccg
gcgctcaagcggtcggcgctgatcggcgggatccgctactacgacgcgcagtccgacgac
gcccgccacacgatgacggtggcgcggaccgcggcgcactacggcgcggtcgtgcggacg
tcgacccaggtcgtcgggttcctgcgcgaagccgaccgggtgtcgggcgtgcgcgtgcgc
gacgtcgaggacggccgcgaaacggagatctcggcggccgcggtgatcaactgcaccggc
gtctggaccgacgagctgcagcgcctgtcgggtggccgcggccggttccgggtgcgcgcg
agcaagggcgtgcacatcgtcgtcccgcgcgaccggatcgtctcggagtcggggatgatc
ctgcgcaccgagaagtcggtgctgttcgtcatcccgtggcgcaaccactggatcgtcggg
acgacggacaccgactgggagctcgacctggcccacccggcggcgacgaagcacgacatc
gactacatcctcgagcacgtcaacacggtcctggcgaccccgctgacccacgacgacatc
gaaggcgtgtacgcgggccttcgcccgctgctggcgggggagagcgaagagacgtcgaag
ctgtcgcgcgagcacgcggtggcgagggtggccccgggcctggtggcgatcgcgggcggc
aagtacacgacgtaccgggtgatggcggcggacgccgtcgacgcggcggcggtggacctg
ccgggccggtcccagccctcgatcacggacaaggtccccctgctgggtgcggacggctac
cacgcgctggtcaaccaggccgaccacttggcggcggaacacggtctgcacccctaccgg
gtgaggcacctcctggaccgctacggctcactggtccacgaggtcctggcctcggcggag
ggccgcccggagctgctgaagccgatcgagcacgccccggactacctgggcgtcgaagtg
gtgtacgcggcttcacacgaaggggcgctgcaccttgaggacgtcctggcccgccggacg
cgcatctcgatcgagtacgcgcaccggggagtggactgcgccgagcaggtggccgccctg
gtgggcgaagtcctgggctggtcgcccgaaacggtgaagcacgagatcgaggtctaccgg
gcccgggtggaggcggagcgcgagtcccagtcccagccgagcgacgaggcggcggacgcg
ttgcggtcagcggccccggaggcccgcgcgggcatcgtggagccggtgagctga

DBGET integrated database retrieval system