KEGG   Amycolatopsis mediterranei U32: AMED_1196Help
Entry
AMED_1196         CDS       T01269                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
amd  Amycolatopsis mediterranei U32
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:amd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMED_1196 (gabT)
   00650 Butanoate metabolism
    AMED_1196 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMED_1196 (gabT)
   00280 Valine, leucine and isoleucine degradation
    AMED_1196 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMED_1196 (gabT)
Enzymes [BR:amd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AMED_1196 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AMED_1196 (gabT)
Amino acid related enzymes [BR:amd01007]
 Aminotransferase (transaminase)
  Class III
   AMED_1196 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1263020..1264375)
Genome map
AA seq 451 aa AA seqDB search
MTASTTAGPQAPAPRQRRLQTEIPGPLSRELQQRRAAAVAAGVSSVLPVYVTSASGGLLT
DADGNVLIDFGSGIAVTNVGHSAPAVVDRVRKQACWFTHTCFMVTPYEGYVEVCEALAEL
TPGDHAKKSVLFNSGAEAVENAVKIARVATGRQAVVVFDHAYHGRTNLTMGMTAKSVPYK
HGFGPFAPELYRVPGSYPFRDGLSGPEAAALAIDRIEKQIGGDQVAAVVLEPIQGEGGFI
EPARGFLPAIAAWCRENGVVYVADEVQTGFCRTGSWFASTDEDVVPDLIATAKGIAGGLP
LSAVTGRAALLDAVGPGGLGGTYGGNPIACAAALGSIETMKTEHLAASAKRIEGVVLPRL
RALASETGVIGDVRGRGAMLAAEFVKPGSAEPDADLTKRVAAACHRAGVVVLTCGTYGNV
VRLLPPLSLADDLLDEGLSVLEHAVRTEVRA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcaagcaccaccgccgggccgcaggcgccggcgccccgccagcgcaggctgcag
accgaaatccccggccccctctcgcgtgagctgcagcagcgccgcgccgccgccgtcgcc
gccggggtcagctcggtgctgcccgtctacgtcacctccgccagcggcgggctgctcacc
gacgccgacggcaacgtgctgatcgacttcggctccggcatcgcggtgaccaacgtcggg
cactccgcgccggcggtggtcgaccgcgtccgcaagcaggcctgctggttcacccacacc
tgtttcatggtcacgccgtacgaggggtacgtcgaagtctgcgaagcgctggccgagctg
acccccggcgaccacgcgaagaagtcggtgctgttcaactcgggcgccgaggccgtcgag
aacgctgtcaagatcgcgcgggtcgcgaccggacgccaggccgtcgtcgtgttcgaccac
gcctaccacggccgcaccaacctcacgatgggcatgaccgcgaaatccgtgccctacaag
cacgggttcggcccgttcgcgcccgagctctaccgggtgccgggctcgtacccgttccgc
gacggcctgtccggccccgaagcggcggcgctggccatcgaccggatcgagaagcagatc
ggcggcgaccaggtggccgcggtggtcctggagccgatccagggcgagggcggcttcatc
gagcccgcgcgcggcttcctgcccgcgatcgcggcgtggtgccgcgaaaacggcgtcgtg
tacgtcgccgacgaggtccagaccggcttctgccgcaccggttcgtggttcgcctccacc
gacgaagacgtggtgccggacctgatcgcgacggccaagggcatcgcgggcggcctgccg
ctgtccgccgtcaccggccgcgctgccttgctggacgccgtcggcccgggtggtctcggc
gggacctacggcggcaacccgatcgcgtgcgccgcggcgctcggctcgatcgagacgatg
aagaccgagcacctcgccgcgtcggccaagcgcatcgaaggcgtcgtgctgccgcggctg
cgggcgctggcctcggaaacgggggtcatcggcgacgtccgcgggcgcggcgcgatgctg
gccgcggagttcgtcaagcccggttcggcggagccggacgccgacctcaccaagcgcgtc
gcggcggcctgtcaccgcgccggggtcgtggtgctgacctgcgggacctacggcaacgtc
gtccggctgctgccgccgctgtcgctggccgacgacctgctcgacgagggcctctcggtg
ctcgaacacgctgtccggacggaggtccgcgcatga

DBGET integrated database retrieval system