KEGG   Astyanax mexicanus (Mexican tetra): 103046845Help
Entry
103046845         CDS       T05042                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 7-like
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103046845
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103046845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103046845
NCBI-ProteinID: XP_022519752
LinkDB All DBs
Position
Unknown
AA seq 921 aa AA seqDB search
MDLRVGERVMRPAGSDTALLSPLQRPLLLNPFTPQHCAQYSQHLRFNMEQHLQDQEDKKQ
QLQLIMHKDKSQQSAVASSVVKQKLAEVILKKRKEKSSTNPLSSTPVAYRELAPDPSVSL
QPHLSSPPQPHPDGPDDPPLRRATSEPKLKVKHKQKKHXEHQEEPLTRKESAPPTIKHRA
PDTLDSSPSSSSTPVSGCSSPNDSLPNENGVLPPAGALSHEAQRILLPDGSLAHFSVPVH
SSLPTITLGLPAHAKVEGEVGGLKLGRVPLVSGGSPVLVPLGVEEQSAPLLQPLFILEPS
GLVHAPLLAVPGLSPLQFSAAPGPHKPLSRTRSEPLPPSPRTLHTHLLHQQHHGNQILHR
LKQHTHLGKLMTKSSEKPRLRQTFLRGIWNSERGVNPGAESMREAESQDDQLNLQQTLIL
NQSRLWETQKQLQQLRRQTAHMETLAVPMMLSGVHRPLSRTQSSPASTSLTLPEKTLPIT
SSTPETHSQPRFTTGLVYDSQMLKHQCTCGDNSTHPEHAGRIQSIWSRLQERGLRVQCES
IRGRKATLEELAVRFHTDSNVLLYGTNPLNRLKLDNRNLAGILSQRMFVMLPCGGVGVDH
DTIWNEMHTSTASRMAAGSVTELAFRVAKGELKNGFAVVRPPGHHADPSNPMGFCFFNSV
AIAAKQLQQKLSVTKILIVDWDVHHGNGTQEIFYNDPSVLYISLHRYDNGNFFPGSGGPT
EVGSGAGEGFNVNVAWTGGLEPPMGDAEYLAAFRTVVMPIAREFSPDVVLVSSGFDAAEG
HPAPLGGYKVTAKCFGFLTRQLMVLAGGRVVLALEGGHDLTAICDASEACVSALLGVEDP
FPEEVLLQKPNDNAVLSLQRVLQIQSQYWSSVKAMVGSVGSAFLGAPAGDCEETAVKALA
SLSVGVLTNKSLPDEPMEHDQ
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcgggtgggggagcgtgtgatgcgtccagcaggatcagacacggctctgctc
tctccactgcagcgccccctactgctcaacccctttaccccccagcactgcgcccagtac
agccagcacttacggtttaatatggagcagcatctccaggaccaggaggacaagaagcag
cagctgcagctcattatgcacaaagacaagagccagcagagtgcagtggccagttcggtg
gtgaagcagaagttggcagaggtgatcctgaagaagaggaaggagaaaagcagcacaaac
cccctcagcagcacacctgtagcgtacagagagttggctccggatcccagcgtctcgctg
cagccccacctctcctcccccccgcagccccatcccgacggacccgacgacccccccctc
aggagagcaacctcagaacccaaactgaaggtgaagcataagcaaaaaaagcacnntgaa
caccaggaagagcccctgacccgcaaagagagcgccccccccaccatcaaacaccgagca
cctgatacactggactcctcccccagtagcagtagtactccagtatccgggtgcagttcc
cctaacgacagtctgcccaatgagaacggagtgctgccccctgctggagctctgagtcat
gaggctcagaggattttattgccggacggatctctggctcatttctcggttccggttcac
tcctccctccccaccatcacactggggctcccggctcacgccaaggtggagggggaagtg
ggcgggctgaagctgggtcgggtgccgctggtgtcgggcgggtctccggttctggtgccg
ctgggtgtggaggagcagagcgcccccctgctgcagccgctgttcatcctggagccgtcc
ggtctggttcacgcgccgctgctggcagttccaggtttgagtccgctgcagttcagcgcc
gcccccggaccccataaacccctgagccggacccggtcagaacccctgcccccgagcccc
cggaccctccacacacacctactgcaccaacagcaccacggcaaccagatcctgcacaga
ctcaaacaacacacacacctgggcaagctcatgacgaagtccagtgagaagccccgcctc
cgacaaacattcctccgaggaatatggaactcagagaggggggtcaatccgggggcagag
tcaatgagggaggcagagagtcaggatgatcaactcaacctacaacagacactcatactc
aaccagtctcggctgtgggagacgcagaagcagctgcagcagttgcgcagacagacggcc
cacatggagacgctggcggttcccatgatgctcagcggcgtccaccggccgctgtcccgc
acccagtcgtcccccgcctccacctccctcaccctgcccgaaaaaaccctgcccatcact
agctccacccccgaaacacacagccaaccacgcttcaccacaggtctggtgtacgactct
cagatgttgaagcatcagtgtacctgtggagataacagcactcacccagagcatgctggg
agaatccagagcatctggtcccgccttcaggagagaggcctgagggtccagtgtgagagt
atacgggggaggaaggcgactctggaggagctggcagtccggtttcacactgactcaaat
gttctgctgtacggcaccaacccgctcaaccgcctcaaactcgacaaccgcaacctcgcc
ggaattctgtcccagaggatgttcgtcatgctgccgtgtggaggagtgggggtcgaccac
gacaccatctggaacgagatgcacacctctacagcgtcgcggatggcggcgggcagcgtg
accgagctggccttcagagtggctaaaggagaactgaagaacggttttgctgtggtgaga
ccaccaggacatcacgcagacccctctaacccaatggggttctgtttctttaactcggtg
gcgatcgctgctaagcagctccagcagaagctgagcgtcactaagatcctcattgtcgac
tgggacgtccatcacgggaacggcacccaggagatcttttacaacgaccccagtgtgctg
tacatctccctccaccgttatgataacggcaacttcttccccgggagtgggggaccaacc
gaggtgggttctggtgctggtgaggggtttaatgtgaacgtggcgtggactggaggtctg
gagccccccatgggtgatgctgagtacctggctgccttcaggacggtggtgatgccgatc
gctcgggagttttctccagatgtggttctggtctcatctggatttgatgcagccgaggga
catccagcaccgttaggaggatacaaagtcacggccaaatgttttgggttcctgacccgg
cagctgatggtgttggctgggggacgtgtggttttggcgctggaaggaggtcacgacctc
accgcaatctgtgatgcatcagaggcctgcgtcagcgctctcctgggagtggaggatccg
tttccagaagaggttctcctgcagaaacccaacgataatgcggttctgtcactacagaga
gttctgcagatacagagtcagtactggtccagtgtgaaggcgatggtgggctcggtgggc
tcggcgtttctcggcgctccggcgggagactgtgaggagacggcagtgaaggctttagcc
tctctatctgtaggagttctgaccaataagagcctccctgatgagccaatggagcatgac
cagtag

DBGET integrated database retrieval system