KEGG   Astyanax mexicanus (Mexican tetra): 103046869Help
Entry
103046869         CDS       T05042                                 

Definition
(RefSeq) transmembrane protease serine 9-like isoform X1
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103046869
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103046869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
4
AA seq 860 aa AA seqDB search
MDWVYLLTLAALLYQDSHGQLDVCGTTGINSRIVGGHDAAAESWPWQASLHLFGGHLCGG
SLINKEWVLSAAHCFYSGSNAASWTVFLGRQSQEGVNPNEVSRRVSVIILHPDYDSDTED
NDIALLKLSSPVNFTRYIRPVCLASDSSVFHSGTESWVTGWGDVAFGVPLPSPQTLQEVE
VPVVGNRQCNCFYGVGTITNNMICAGLLEGGRDSCQGDSGGPMVSRQGSVWVQAGVVSFG
YDCAQPEFPGVYTRVSRYQTWISSLITSDPPGFIQFQSSGVDPDRSYTCPGLPPPVTDTP
EISTVAPATENQSSTVCGSVPLLSRIVGGQDAPAGRWPWQASLHWNRFHACGGSLINREW
VLSAAHCFFSSSTSEWTVYLGRQSQEDDNPNELFRSVDVIITHPDYDFNAAENDNDMALL
KLSAPVIFTDYIRPVCLAADSSVFHTGTDSWVTGWGDVREDVPLPSPQTLQEVEVPVVGN
RQCRCLYRNTAAVTDNMICAGLLEGGRDSCQRDSGGPMVSRQGSVWVQAGVVSFGYGCAQ
PGFPGVYTRVSRYQTWISSLITSDPPGFIQFQTSGVDPDRSYTCSTSAPPRSSSVSQQHG
CGEAPGGGGVWPWMVSLQWNGLHMCTASLLSADFIMTTASCLSDFSQNASGWRASLGYQS
NRNSSDPFLLSVAVINITLSNLNHGLNISVLQLEEPVEFSDLVQPVCLDLDNRRSFPPGL
TCLFTGYKNNNSTGLVLEEQQVTVMDCGRNLSSSESICTGSLSPKQDGVGGVLACVSGVS
WFQVGVIMLDYGDSGLQVFSRVSQFGNFLQRTVPDLPQPPTVAPLPSNHETPPSAGAPLA
PISCYRNAIVFTVLVLLLLS
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggactgggtttatttgctgactctggctgctcttctttaccaggactctcatgggcag
ttagatgtgtgtggcaccactgggattaacagcaggatagtaggaggtcatgatgccgca
gcagagagctggccctggcaggcgagtctgcatctgttcggagggcacttgtgcggaggt
tccctcatcaataaagaatgggtgctgtctgcagcacactgcttctactcaggatccaat
gcagcaagctggactgtgtttctgggacgtcaaagtcaagaaggcgtgaacccaaatgag
gtctccagacgagtctctgtgataatcctgcaccctgactacgactccgacacggaagat
aacgatattgctctactcaaactgagcagcccggtcaacttcaccagatacatcagacca
gtgtgcctggcatcagatagcagtgtttttcacagcgggacagagagctgggtcactgga
tggggagacgtggcatttggtgtgcctcttccgtctccacagactttacaggaggtggag
gttccagttgtgggaaacaggcagtgtaactgtttttacggtgttggaacaatcacaaac
aacatgatatgcgctggtttactggaaggaggaagagactcatgtcagggagactcggga
ggtccgatggtgagcaggcagggctcggtgtgggttcaggccggtgtggtgagtttcggc
tatgattgtgctcagcctgagtttcctggagtttacaccagagtgtcccgctaccaaacc
tggatcagctctctgatcaccagcgaccctccaggattcatccagttccagtccagtgga
gtcgaccctgacagatcatacacctgccctggcctgccgccaccagtgactgacaccccg
gaaatctccacagtggctccagccacggagaaccagtcatctactgtttgtggtagtgtc
ccgctcctgtccaggatagtaggaggtcaggacgcccccgctggacgctggccatggcag
gcgagcctacactggaacagatttcatgcttgtgggggttctcttattaacagggaatgg
gttctgtctgcagctcactgtttcttcagctccagtacatctgagtggactgtgtatctc
ggtcggcagagtcaggaggacgacaaccccaacgaattgttcagaagtgtggatgtgatc
atcacacatcctgattacgactttaacgctgccgagaatgataacgatatggctctgctg
aagctgagtgctccggttatcttcactgactacatccggccggtgtgtctggcagcagac
agcagtgttttccacacgggaacagacagctgggtcaccggctggggggacgttcgggaa
gacgtgccgcttccctctcctcagactctacaggaagtggaagtgcctgtagtgggaaac
agacagtgccgctgcctctacaggaacactgcagccgtcacagataacatgatctgcgcc
ggcctgctggagggaggcagagactcctgtcagcgagactctggaggtccgatggtgagc
aggcagggctcggtgtgggttcaggccggtgtggtgagtttcggctatggttgtgctcag
cctgggtttcctggagtttacaccagagtgtcccgctaccaaacctggatcagctctctg
atcaccagcgaccctccaggattcatccagttccagaccagtggagtcgaccctgacaga
tcatacacctgcagcaccagcgccccaccgaggtccagctccgtctcccagcagcacggg
tgtggagaggcccctggaggaggaggggtgtggccctggatggtcagcctgcagtggaac
gggttacacatgtgcaccgcctcgctgctgagcgctgatttcatcatgaccaccgcatcc
tgcctttcagatttttcccagaatgccagtggctggagagcgtctttaggctatcagtct
aacagaaacagctcagatcctttcctgctctctgtggctgtgataaatatcaccctcagt
aacctgaaccacgggctgaacatctccgtgctgcagctggaggagccggtggagttcagt
gatctcgtccagcctgtgtgtttggacctggataaccggaggagctttccccccgggtta
acctgcttattcaccggctataaaaataacaattctacaggtttagtgctggaggagcag
caggtgacagtaatggactgtggtagaaacctctcctcatctgagtccatctgcactgga
tctctgtctcctaaacaggatggtgtaggaggggtgttagcgtgtgtatcaggtgtgtcc
tggtttcaggtgggtgtgattatgttggattatggagattcaggactgcaggttttctcc
agggtctctcagtttgggaatttcctccagagaactgtccctgatcttcctcagccgccc
accgtcgcccccttaccctccaaccacgagacccccccatcagcgggggctccgctagct
cccatatcctgttacagaaatgctattgtctttactgtcttagtattgttattattatca
taa

DBGET integrated database retrieval system