KEGG   Alligator mississippiensis (American alligator): 102568786Help
Entry
102568786         CDS       T03087                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00240  Pyrimidine metabolism
amj00983  Drug metabolism - other enzymes
amj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102568786 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102568786 (TK1)
Enzymes [BR:amj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102568786 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 102568786
NCBI-ProteinID: XP_006270710
LinkDB All DBs
Position
Un
AA seq 225 aa AA seqDB search
MSCGPVSAAGGAGSPGKARGQIQVIFGPMFSGKSTELMRRVRRFQLAQHRCLLVKYAKDT
RYGLGGVCTHDRNTMEALAACCLKDVYQEALGSAVIGIDEGQFFPDIVEFCEAMANAGKT
VIVAALDGTFQRKAFGSILNLVPLAESVVKLNAVCMECYQEASYTKRLGAEREVEVIGGA
DKYHSVCRLCYFRKRRQPSGPENKENLPMGVKQLEAAVSRKVFAS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgggccggtgtcggcggccggcggggccgggtcccccggcaaggcgcgcggg
cagatccaggtgatcttcgggccgatgttctccgggaagagcacggagctgatgcgccgc
gtgcgccggttccagctggcgcagcaccgctgcctcctggtgaagtacgccaaggacacg
cgctacggcctgggcggggtgtgcacgcacgaccggaacaccatggaggcgctcgcggcc
tgctgcctcaaagacgtgtaccaggaggcgctcggctcggcggtgatcggcatcgacgaa
ggccagttcttcccagacatcgtggagttttgcgaggcaatggccaacgctgggaagact
gtaattgtcgctgctctggatggcaccttccagaggaaggcgtttgggagcatcctgaac
ctggtccccttggcagagagcgtggtgaagctgaacgccgtgtgcatggagtgttaccag
gaagcctcgtacaccaagaggctgggagcagagagagaggttgaagtgatcgggggggcg
gacaagtatcactctgtctgccgcctctgttacttccggaagcgccgccagccgagcggg
cccgagaacaaggagaacctgcccatgggggtcaagcagctggaagccgctgtctctcgc
aaggtgtttgcttcgtga

DBGET integrated database retrieval system