KEGG   Alligator mississippiensis (American alligator): 102573284Help
Entry
102573284         CDS       T03087                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amj  Alligator mississippiensis (American alligator)
Brite
Enzymes [BR:amj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102573284 (ACE)
Peptidases [BR:amj01002]
 Metallo Peptidases
  Family M2
   102573284 (ACE)
Exosome [BR:amj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102573284 (ACE)
CD molecules [BR:amj04090]
 Proteins
  102573284 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1279 aa AA seqDB search
MPPLLRLLLLFLSPAAALEASLLPPEGDPTEQGAVLFADKYNSTAEIVLFKSVNASWNYN
TNLTDFNSNLQIMASLEEQNFTEAWGKKAKQLYGPIFRNFTDLQLKKIIGSIQTLGPSNL
PMNKREQYNTILSEMDNIYSTAKVCPPHQMSNCWSLEPEVSDIMANSRSYKKLLYAWEGW
HNSAGNPLRPKYEEFVKLSNEAYRMDNFADTGAYWRSWYDSPTFEDDLEQLYHQLEPLYL
NLHAFVRRKLYDRYGAKYINLKGPIPAHLLGNMWAQQWNNIYDMMIPYPNKPNLDVTNAM
NQKNWNATHMFRVSEEFFTSLGLLGMPPEFWAESMLEKPTDGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTFRSGANPGFHEAIGDVMGLSVSTPS
HLKKIGLLDQVVQDTENDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTSPNRYNYDW
WYLRTKYQGICPPIARNETNFDPGAKYHIPANTPYIRYFVSFILQFQFHKALCQAANHTG
PLHTCDIYQSKEAGTKLSEMLKVGSSKPWQEILFTMTGTRKMDAGALLEYFKPVTEWLEQ
QNNKTQETLGWPDFEWRPPVPEGYPEGIDKIADEAQAKEFLAEYNRTAEVVWNAYTEASW
TYNTNITDHNKQIMLEKNLLMSNHTLQYGMKARQFDYSDFQDQSMKRILKKLSDIERAAL
PKDELEEYNKLLSDMETTYSIAKVCKENDKCYPLDPDLTNILATSKDYDELLFAWKGWRD
ASGNQIRTKYKRYVELSNKAARLNGHADNGAFWRSLYETPTFEEDLEKLYLQLQPLYLNL
HAYVRRALYNKYGKEYINLKGPIPAHLLGNMWAQSWSAIFDLLTPFPSATKVDATPAMKS
QNWTPKRMFQESDNFFTSLDLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRI
KQCTVVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVSTPKHL
HSINLLPQVEDNMESDINYLMSIALDKIAFVPFGYLMDQWRWKVFDGRIKEDEYNQQWWN
LRLKYQGLCPPVPRSEADFDPGAKFHIPANVPYVRYFVSFVIQFQFHQALCKAAGHTGPL
YKCDIYKSKEAGTLLGNALKLGFSKPWPEAMQLITGQPNMSADALMMYFEPLMTWLVDVN
KKNGDILGWSDYDWTPYAARTESTVNFLGMSLDRNQATAGQWVLLVLGLVLLLSTIVLGV
KCYSARRRAYKSGSEMELK
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcttttaaggctcctgctgctgttcctcagcccggctgctgccttggaagcc
agtctcttgccccctgagggtgaccccactgagcaaggggctgtcttgtttgcagataag
tacaacagcacagctgagatagtcctgttcaagagtgtgaatgccagctggaattacaac
accaacctgaccgacttcaactccaacctgcagatcatggcctcgctggaggagcagaat
ttcacggaggcctggggcaagaaagccaagcaactctatggccccatcttcagaaatttc
acagacctacaactgaagaaaatcattggctccatccagaccttggggccttccaacctg
cccatgaacaagcgggagcagtacaacaccattttgagtgagatggacaatatctattcc
actgccaaggtgtgtcctccacaccagatgtccaactgctggtcattggaaccagaggta
tctgacatcatggccaattcccgcagctacaagaagctgctgtatgcctgggaggggtgg
cacaactctgctggcaaccccctgaggcccaagtatgaggagtttgtgaagctgagtaac
gaagcctacaggatggacaattttgcagacactggtgcttactggcgctcctggtatgac
tcacccacttttgaggatgatctggaacaactctaccatcagctggaacccctctacctg
aacctgcacgctttcgtcaggaggaagctgtatgaccgctatggtgccaagtacatcaac
ctcaagggacccatccctgctcatttgctgggcaacatgtgggctcagcagtggaacaac
atctatgacatgatgatcccctacccaaacaagcccaatctggatgtcacaaatgccatg
aatcagaaaaactggaacgccacgcacatgttccgggtctcggaggagttcttcacttcc
ctggggcttctggggatgcccccggagttctgggctgagtccatgctggagaagcctacg
gatgggcgggaggtggtgtgccatgcctcagcctgggacttctacaaccgcaaggatttc
aggataaagcagtgcaccacagtcaccatggagcagctcttcaccgtgcatcatgaaatg
gggcatgtcgagtactatctgcagtacaaggaccagcctgtcaccttccgcagcggggcc
aaccctggcttccatgaggccattggagatgttatgggcctgtcagtctccaccccaagc
cacctcaagaagattgggctccttgaccaggtcgtccaggatacagagaatgacatcaat
tatctgctaaaaatggccctggagaagattgccttcctgccttttgggtaccttattgac
cagtggcgctggaacgtcttcagtgggcacacctcaccaaaccgctacaactacgactgg
tggtacctgagaacaaaatatcagggaatatgtcctcctattgcaaggaatgaaaccaac
tttgatcctggtgcaaagtatcatatccctgccaacacaccctacatcagatactttgtg
agcttcatcctgcagttccagttccacaaggccctgtgccaagctgccaatcatacaggc
cccctgcacacctgtgacatctaccagtccaaagaagctggaacaaaactcagtgagatg
ctgaaagttggttcttccaagccatggcaagaaatcctgttcactatgactggcaccaga
aagatggatgctggggcactgttggagtacttcaaacctgtgacagaatggctggagcaa
cagaacaacaaaacccaggaaaccctgggctggccagactttgagtggcgcccgcctgtt
cctgagggctaccctgagggcattgataaaatagcggatgaagcacaagctaaagaattc
ttggcagagtacaaccgaacagctgaagtggtatggaatgcctacaccgaagcatcctgg
acatacaacaccaacatcactgatcacaataagcagatcatgctggaaaagaacctgttg
atgtccaatcacaccctgcagtatggcatgaaggcccggcagtttgactactccgacttt
caggaccagagcatgaagcgcatccttaagaagctgagcgacattgagagggctgcattg
cccaaggatgagctggaggagtacaacaaacttctctcggacatggagaccacatacagc
atagccaaggtctgcaaggaaaacgacaagtgctatccactggatcctgaccttaccaac
atcctcgccacctcaaaggattatgatgagctcctttttgcctggaagggctggcgggat
gcctctgggaatcaaatcagaaccaaatacaagagatatgtggagctaagcaacaaggca
gccagactcaatggtcatgctgacaatggtgccttctggagatccctctatgaaacaccc
acctttgaagaggacctagagaagctctacctgcaactgcagcccctgtacctcaacctt
catgcctatgtgcgccgagccctctacaacaaatatgggaaggagtacatcaacttgaag
ggccccatcccagcccacctgctaggaaacatgtgggcccagtcatggtctgccattttt
gatctgctgacacctttccctagtgccaccaaagtggatgccaccccagccatgaaaagc
cagaactggacccccaagaggatgtttcaggagtcagacaatttcttcacctctctggac
ttgatccctatgccccaggaattctgggacaagtccatgattgagaagccatcggatggg
cgggaagtggtgtgccatgcctcagcctgggacttctacaaccgcaaggacttcaggatt
aagcagtgtacggtggtgaacatggatgacctgatcactgtgcaccatgagatgggccac
gtccagtacttcctgcagtacaaggaccagcccatatctttccgtgatggagccaaccct
ggcttccatgaggccattggggatgtcatggccctgtcagtctccacccctaagcacctg
cacagcatcaaccttcttcctcaggttgaggataatatggagagcgacatcaattacctg
atgagcattgccttggacaagattgcctttgtgccttttggctaccttatggaccagtgg
aggtggaaggtgtttgacgggaggataaaggaagatgaatataaccaacagtggtggaac
ctcaggttgaaataccagggcttgtgcccacctgtgcccaggtcagaagctgactttgat
cctggtgccaagttccacatccctgccaatgtgccatatgtcaggtactttgtcagcttt
gtgattcagttccagttccaccaagccctctgcaaagcagctggacacactggccccttg
tacaagtgtgacatctacaaatccaaggaggcagggaccctcctggggaatgccctgaag
ctgggctttagcaaaccctggccagaggccatgcagcttatcaccgggcagcccaacatg
tctgcagatgccctgatgatgtattttgagccgctgatgacctggctggtggatgtgaac
aagaagaatggggacattctgggctggtctgattacgactggacgccatatgcagctcga
acagagtctacagtcaattttctggggatgtctctggatcgcaatcaagccactgctggc
cagtgggtcctgcttgtcctgggactggtcctgcttctgtccaccattgtccttggagtc
aaatgctactctgcaaggcggagggcctacaaatccggctcagaaatggaactgaaataa

DBGET integrated database retrieval system