KEGG   Alligator mississippiensis (American alligator): 102574756Help
Entry
102574756         CDS       T03087                                 

Gene name
EHMT2
Definition
(RefSeq) euchromatic histone lysine methyltransferase 2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
amj00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:amj00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102574756 (EHMT2)
Enzymes [BR:amj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102574756 (EHMT2)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102574756 (EHMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3 SET Pre-SET YL1 TFIIA CDC45 BSP_II ATG2_CAD Mpp10 Nop14
Motif
Other DBs
NCBI-GeneID: 102574756
NCBI-ProteinID: XP_019333694
LinkDB All DBs
Position
Un
AA seq 1164 aa AA seqDB search
MGQGPPPEPSALLCPAEAGASGDEVAPRTQVSGSNKEPEAESSPAAGASPGGRGLPGHAA
KTLPSPPVGPGGPPSRAKMSLTGAGKSPPSVQSLAMRLLSLPGAGPAPSMGPAPAEAPPL
APPSPEPKPKVHRARKTMAKPGNGQVPEKRVSEMLHFRVSDDLRSIEEPEPAKRRKLDYG
PESLHKRLPPTLPRASTEITVTEEMAARPLGPAGEDRGPDEWEAEVGADFSLFYDSYSVD
GHNDSDSKSEADGAGEQLSEEEEEEEEEDEEEEEEEDDEDDDDEDEESGNTSDRSASSTK
RKARKRWKSDSPWVKPSRKRKRKDPRPKDPRGVNGGPAPGQGDYTELPLGCLELPNEGAL
SPPHAGVSNETSSLETERCEELPLCSCRMEAPKIERLGPAARAHCMATESVDGQLSGCNS
SILKRETMRPSSRVPLMVLCETHRARMVKHHCCPGCGYFCTAGTFLECHPDFRITHRFHK
SCVSTLNGLVFCPHCGEDASEAQEITIARADTSTPAPAPRPPGHEPPRADSTQPSARMRG
QGEGRAAPPDPRADAIDSSGGPVLPLPSGAALSALGLAPGLGREQLEKALVVQESERRKK
LRFHPRQLYLSVKQGELQKVVLMLLDNLDPNFQTDQQSKRTPLHAAAQKGFLEICHVLLQ
AGANINAVDKTRRTPLMEAVANNHVEAARYMVRRGGCVYSKEEDGSTCLHHAAKNGNLEM
VDLLLSTGQVDVNAQDNGGWTPIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWAS
FTGSAAIAEVLLNARCDLHAVNCHGDTPLHIAARESYRDCVTLFLSRGADTELRNKEGDS
PLDLTLEHSDVWVALQLNRKIRQGAASRGLRTERIISRDVARGYENVPIPCVNAVDDEPC
PSDYKYIAENCETSAMSIDRNITHLQHCTCQDDCSSSNCLCGQLSIRCWYDKDGRLLQEF
NKIEPPLIFECNQACACWRTCKNRVVQSGIRVRLQLYRTAKMGWGVRALQAIPQGTFICE
YVGELISDAEADVREDDSYLFDLDNKDGEVYCIDARYYGNVSRFINHLCDPNIIPVRVFM
LHQDLRFPRIAFFSSRHIRAGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEALALEQ
SRLARLDAPHDLLPDLPALPLPAP
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgggccagggcccccccccagagccctccgccctcctctgccctgccgaggcaggggcc
agtggggacgaggtggcaccgaggacccaggtgtctgggagcaacaaagagcccgaggct
gagagcagccccgcagccggcgccagccccgggggcagggggctgccaggccacgctgcc
aagaccctgccgtcaccgccagtggggcccggggggcccccgagccgggccaagatgtca
ctgaccggggcagggaagtcgcccccctcggtgcagagcttggccatgcggttgctaagc
ctgccgggtgctggccctgcccccagcatgggccccgcccctgctgaggccccgcctttg
gcacccccaagcccggagcccaagcccaaggtgcaccgggcccgcaagaccatggccaag
cccggcaacggacaggtgccagagaagcgcgtctccgagatgctgcacttccgcgtctcc
gacgatctccgtagcatcgaggagccagaacccgccaagcgccggaaactggactacggc
cctgagtccctgcacaagcgcctgccgcccaccttgccccgtgccagcactgagatcacg
gtgacggaggagatggcagcacggccattggggccagcgggcgaggatcggggccccgat
gagtgggaggccgaggtgggagccgacttcagcctcttctacgacagctactcagtggat
gggcacaatgactcggacagcaagtcagaggcggatggggctggggagcagttgagtgaa
gaggaggaggaggaggaagaggaggacgaggaagaggaagaggaggaagacgatgaggac
gacgatgatgaggatgaagagtccgggaacacctcagataggagcgcatcaagcaccaag
cggaaggcgcggaagcgctggaagagcgacagcccctgggtgaagccgtcacgcaaacgc
aagcgcaaggacccccgccccaaggacccccgaggtgtgaacggggggccggcgccaggc
cagggcgactacacagagctgccccttggctgcctggagctgccgaatgagggagccctg
tccccgccccatgcaggggtgtcaaacgagacaagctcgctggagacagagcgctgcgag
gagctgcccctctgctcctgccgcatggaggcccccaagatcgagcgtcttggcccagca
gcccgcgcccattgcatggccacggagagcgtggacgggcagttgagcggctgcaacagc
agcatcctgaagcgtgagacgatgcggccatccagccgtgtgcccctgatggtcctgtgc
gagacccaccgcgcccgcatggtcaagcaccactgctgccctggctgcggctacttctgc
accgccggcacgttcctggagtgtcaccctgacttccgcatcacccaccgcttccacaag
agctgcgtctccaccctcaacggcctcgtcttctgcccgcactgtggtgaggatgcttct
gaggcccaggagatcaccattgcccgggctgacacctccacgcccgcccccgcaccccgg
ccccctggccacgagcccccccgcgctgactccacccaacccagcgcacggatgcggggc
cagggtgaggggcgggcggcgcccccagacccgcgggccgacgccatcgacagctcggga
ggcccagtgctgcccctgccctccggcgctgctctctcagccctgggcctggccccaggg
ctcgggcgtgagcagctggagaaggccctagtcgtgcaggagtctgagagacgcaagaag
ctgcgtttccacccacgccagctctacctctcggtgaagcagggggagctgcagaaggtt
gtgctcatgctgctggacaacctggaccccaacttccagactgaccagcagagcaagcgc
accccactgcatgctgccgcccagaagggcttcttggagatctgtcacgtgctgctccag
gcgggcgccaacatcaatgcggtggacaagacgcgtcggacgccactgatggaggccgtg
gccaacaatcacgtggaggccgcacgttatatggtgcgccgcggcggctgcgtctacagc
aaggaagaggacggctccacctgcctgcaccacgcagccaagaatggcaacctggagatg
gtcgacctgctgctttccaccggccaggtcgacgtcaatgctcaggacaatggcggctgg
acccccatcatctgggcggccgagcacaagcacatcgacgtcatccgcatgctgctgacc
cgcggtgccgacgtcaccctcacagacaacgaggagaacatctgcctgcactgggcctcg
ttcacgggcagtgctgccattgctgaggtgctgctcaatgcccgctgtgacctgcacgca
gtcaactgccacggcgacacgccactgcacatcgccgcccgtgagagctaccgcgactgc
gtcacactgttcctgtcgcggggggccgacacagagctgcgcaacaaggagggcgactcc
ccgctggacctgacgttggagcactcggatgtgtgggtggcattgcagctcaatcgcaag
atccgccagggggcggcctcgcgtggcctgcgtactgagcgcatcatcagcagggacgtg
gcgcggggctacgagaacgtgccgatcccatgcgtgaacgcagtggacgatgagccctgc
cccagtgactacaagtacatcgctgagaactgtgagacctcggccatgagcatcgaccgc
aacatcacccacctccagcactgcacctgccaggatgactgctcctccagcaactgcctc
tgcggccagctcagcatccgctgctggtacgacaaggacgggcggttgctgcaggagttc
aacaagatagagccaccgctgatcttcgagtgcaaccaggcctgcgcctgctggaggacc
tgcaagaaccgcgtcgtgcagagcggcatccgggtgcggctccagctctaccgcacagcc
aagatgggttggggggtgcgggcactgcaggccatcccgcagggcaccttcatctgcgaa
tacgtgggggagctgatctcggatgcagaggccgacgtgcgggaggatgactcctacctg
ttcgacttggataataaggatggcgaggtgtactgcattgacgcgcgctactacggcaac
gtgagccggttcatcaaccacttgtgtgaccccaacatcatccccgtgcgtgtgttcatg
ctgcaccaggacctgcgcttcccccgcatcgccttcttcagcagccgccacatccgagcc
ggcgaggagctggggttcgactatggggaccggttctgggacatcaagagcaagtacttc
acgtgccagtgcgggtcggagaagtgcaagcactcggctgaggcgctggccctggagcag
agccgcctggcacgcctcgatgccccccatgacctgctgcctgacctgcctgccctgccc
ctgcccgcgccctga

DBGET integrated database retrieval system