KEGG   Alligator mississippiensis (American alligator): 102576843Help
Entry
102576843         CDS       T03087                                 

Gene name
HDAC4, HDAC9
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
amj  Alligator mississippiensis (American alligator)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:amj00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102576843 (HDAC4)
Enzymes [BR:amj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102576843 (HDAC4)
Chromosome [BR:amj03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102576843 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1087 aa AA seqDB search
MSSQNHPDGLSARDQPVELLNPPRVNHMPSSVDVTATLPLQVAPTSVPMDLRLDHQFSMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGP
SSPNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPA
TGPSSGGSGQQDAERLAIPTLQQRISLFPGTHLTPYLSTTTLERDGGTAHNPLLQHMVLL
EQPTAQTPLVTDWYLSGLGALPLHAVVSGDRVSPSIHKLRQHRPLGRTQSAPLPQNAQAL
QQLVIQQQHQQFLEKHKQQFQQQQLHINKMIPKPTEPTRQHESHPEETEEELREHQALLE
EPYSDRVSSQKEVQGLANMVQVKQEPIESDEEETEPQQELEPGQRQAEQELLFRQQALLL
EQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLV
YDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSE
AHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGC
VIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIV
DWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGG
LDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLT
KQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPERVFQQRANANAVQSM
EKVIEIHSKYWHSLQRYASTVGYSLIEAQKCENEEAETVTAMASLSVGVKPAEKRPDDEP
MEEEPPL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaaatcatccagatggactttctgcccgagaccagccagtggaactgctg
aatccacctagagtgaaccacatgcctagttctgttgatgtgactgcaacactgcccttg
caagttgcaccaacttcagttcctatggacctccgtttggaccatcagttttccatgcct
gtgacagagccaacactccgtgaacagcagctccagcaagagctcctggctctcaaacaa
aaacaacaaatccagagacaaatcctcattgctgagttccagaggcagcatgaacagctc
tctcggcagcatgaggcccagctacacgagcacataaaacaacagcaggagatgctagca
atgaaacatcagcaagaactcttggagcaccagaggaagttggaacaacaccgacaggag
caggagctagagaagcagcatagagaacagaaactacagcagctcaaaaataaagagaaa
ggaaaagaaagtgcagtggcaagcacagaagtaaaaatgaaattacaagagtttgtcttg
aataaaaagaaggctttggcacaccggaatctcaaccattgcatttccagtgatccccgc
ttctggtatgggaaaacacagcatagttctcttgaccagagttcacctccccaaagtgga
gtatcaggcacctataaccaccctgtactggggatgtatgattccaaagacgactttcca
ctcagaaaaacagcttctgaacccaatctgaaattacgatccaggctaaaacaaaaagtt
gctgaaagacggagcagcccattgttacggagaaaagatggcccagtggttactgctctt
aagaagcgtccattggatgttacagactctgcatgcaacagtgctcctggatctggtccc
agttctccaaacaacagctccaataacataagtgctgagaatggaattacaggatcagtc
acaagtattcaggcagagaccagcttggctcacagactagtgaatcgcgaaggttcagta
acacagcttcctctctacacatctccttccttgcccaacataacattaggactgcctgca
actggcccttccagcgggggatcaggacagcaggatgctgagagacttgctattccaacc
ttacaacagaggatctctttatttcctggcacccaccttactccctatttgagcactaca
acgttggaaagggatgggggaactgcacacaaccctctcctgcaacatatggtcttactg
gaacaaccaactgcacaaacgcccttagtcacagactggtatctttcaggactgggggca
ctgcccctccatgcagtggtcagtggagatcgggtctccccctcaattcacaagctccgg
cagcaccgcccgctggggcgcacgcagtctgctcccctgccccagaacgcccaagccctc
cagcagttagtgatccagcagcagcatcagcagtttctggagaaacacaaacagcagttc
cagcaacagcaactgcacattaacaagatgataccaaaacctaccgagccaactcgccag
catgaaagccaccctgaggagacggaagaagaattacgagaacaccaagcacttttggag
gagccatacagtgacagagtttcgagtcaaaaggaggtgcaagggttggccaatatggta
caggtgaaacaagaacccattgagagtgatgaagaggaaacagagccacaacaggagcta
gagcctggccagaggcaagctgaacaggagctgctgttccgccagcaagcccttttactg
gagcagcaacgcattcaccagctgagaaactaccaagcatcaatggaggcagctggcatc
ccagtgtcttttggagggcaccggcctctgtcccgggcacagtcctcacctgcttctgcc
acctttcccatgtctgtacaggagccacccactaagccaaggttcacaacaggccttgta
tatgacaccttgatgctgaaacaccagtgtacctgtggaaacacaaacagccacccagag
catgcagggagaatccagagcatctggtcccgccttcaggagacaggcctccgtggcaaa
tgtgagtgcattcgtggaagaaaagcaactctagaagagctacaaacagttcactcagag
gcccatacactgctgtacggaacaaaccctctgaacaggcagaaactggacagcaagaaa
cttctaggttctctaacatcaatgtttgtcaggctcccttgtggtggtgttggagttgac
agtgacacaatttggaatgaggttcattcatctggtgctgctcgcttggctgtggggtgt
gtcattgaacttgtttttaaagtggccacaggagaattaaagaatggatttgctgtagtt
cgacctccaggtcaccatgcagaagaaagtacacccatggggttttgctattttaattct
gtggcaattgcagccaagcttctccaacagagactgaacgttagcaaaatccttatagtg
gactgggatgtacaccatggaaacggtactcagcaagctttctacaatgaccctaatgtt
ctttatatttcactacatcgctatgatgatgggaacttcttcccaggcagtggagctcct
gatgaggtcggcacaggaccaggtgttggtttcaatgttaatatggcctttactgggggc
cttgatccaccaatgggagatacagaatacttaactgctttcagaacggtagtgatgcca
attgccaatgaatttgccccagatgttgtgctggtatcatctggttttgatgctgtggaa
ggtcatcctacacctcttggagggtataatctatcagcaaaatgctttgggtacctgacg
aagcagctgatgggattggccggaggtcgaattgttctggcccttgaagggggtcatgac
ctgacagccatttgtgatgcatctgaagcatgtgtttctgctttgctgggaaacgagctt
gatcctcttccagaaagggttttccagcagcgagcaaatgctaatgccgtgcagtccatg
gaaaaagttattgagatacacagcaagtattggcattcactccagcgttatgcctccacg
gtagggtactccttgattgaggcacagaagtgtgaaaatgaagaagcagaaactgtaaca
gccatggcatccttgtcagtaggtgtgaagccagctgaaaagagaccagatgatgaaccc
atggaagaggagcctcccctgtag

DBGET integrated database retrieval system