Ailuropoda melanoleuca (giant panda): 100474348 Help Entry 100474348         CDS       T01329                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism aml  Ailuropoda melanoleuca (giant panda) Pathway aml04060   Cytokine-cytokine receptor interaction aml04061   Viral protein interaction with cytokine and cytokine receptor aml04062   Chemokine signaling pathway aml04621   NOD-like receptor signaling pathway aml04657   IL-17 signaling pathway aml04668   TNF signaling pathway aml04933   AGE-RAGE signaling pathway in diabetic complications aml05135   Yersinia infection aml05142   Chagas disease aml05144   Malaria aml05163   Human cytomegalovirus infection aml05164   Influenza A aml05168   Herpes simplex virus 1 infection aml05171   Coronavirus disease - COVID-19 aml05323   Rheumatoid arthritis aml05417   Lipid and atherosclerosis aml05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:aml00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100474348   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100474348    04061 Viral protein interaction with cytokine and cytokine receptor     100474348  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100474348    04657 IL-17 signaling pathway     100474348    04062 Chemokine signaling pathway     100474348  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100474348    05164 Influenza A     100474348    05168 Herpes simplex virus 1 infection     100474348    05163 Human cytomegalovirus infection     100474348   09171 Infectious disease: bacterial    05135 Yersinia infection     100474348   09174 Infectious disease: parasitic    05144 Malaria     100474348    05142 Chagas disease     100474348   09163 Immune disease    05323 Rheumatoid arthritis     100474348   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100474348    05418 Fluid shear stress and atherosclerosis     100474348   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100474348  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:aml04052]     100474348    00536 Glycosaminoglycan binding proteins [BR:aml00536]     100474348 Cytokines and neuropeptides [BR:aml04052]  Cytokines   Chemokines    100474348 Glycosaminoglycan binding proteins [BR:aml00536]  Heparan sulfate / Heparin   Chemokines    100474348 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100474348 NCBI-ProteinID:  XP_002912400 LinkDB All DBs Position 13:8577014..8578865 Genome browser AA seq 101 aa AA seqDB search MKVSATLLCLLLTAAAFSLQVLAQPDAISSPVTCCYTLTNKKISMQRLGSYKRVTSSKCP KEAVIFKTILNKEICADPNQKWVQDSMAHLDKKTQTQTAKP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgccacgcttctctgcctgctgctcacagccgccgccttcagcctccag gtcctcgcccagccagatgcaattagttctccagtcacctgctgctatacactcaccaat aagaagatctcgatgcagaggctggggagctataaaagagtcaccagcagcaagtgtccc aaagaggctgtgatcttcaagaccatccttaacaaggagatctgtgctgaccccaaccag aagtgggtccaggattccatggcacacctggataagaaaacacaaacgcaaactgcaaag ccatga

DBGET integrated database retrieval system