KEGG   Ailuropoda melanoleuca (giant panda): 100481235Help
Entry
100481235         CDS       T01329                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00590  Arachidonic acid metabolism
aml01100  Metabolic pathways
aml04611  Platelet activation
aml04726  Serotonergic synapse
aml04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100481235 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100481235 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100481235 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    100481235 (PTGS1)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100481235 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100481235
NCBI-ProteinID: XP_002915993
Ensembl: ENSAMEG00000000730
LinkDB All DBs
Position
Un
AA seq 601 aa AA seqDB search
MSRRSPLLRFPLLLLLLLPPPQVLPADPRTPAPVNPCCYYPCQHQGICVRFGLDRYQCDC
TRTGYSGPNCTIPELWTWLRNSLRPSPSFLHFLLTHGRWFWEFINATFIRDMLMRLVLTA
RSNLIPSPPTYNIAHDYISWESFSNVSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQLLGH
RFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLE
RQYQLRLFKDGKLKYQVLDGEMYPPSVEKAPVLMHYPRGVLPRSQMAVGQEVFGLLPGLM
LYATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLRL
KFDPELLFSAQFQYRNRIAMEFNQLYHWHPLMPDSFKVGSQDYSYEQFLFNTSMLVDYGV
EALVDAFSRQSAGRIGGGRNIDHHVLHVAVEAIKESRELRLQPFNEYRKRFGMRPYTSFQ
ELTGEKEIAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPI
CSPEYWKPSTFGGEMGFNMVKTATLKKLVCLNTKTCPYVSFHVPDPHQDGGPGVERPSTE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgagccggaggagtcctttgctccggttcccgctgctcctgctgcttctgctgccgccg
ccccaggtcctgcccgcggatccccggacccccgcgccggtgaacccctgttgttactac
ccatgccagcaccaggggatctgtgtccgcttcggccttgaccgctaccagtgtgactgt
acccgcacgggctattctggccccaactgcaccatccccgagctgtggacctggctccgg
aattcactgcgacccagcccctctttcctccacttcctgctgacgcatgggcgctggttc
tgggagttcatcaatgccaccttcatccgtgacatgctcatgcgtctggtactcacagct
cggtccaaccttatccccagcccccccacctacaacatagcgcacgactacatcagctgg
gagtccttctccaatgtgagctattacacccgtgttctgccctctgtgccccaagactgc
cccacgcccatggggaccaaagggaagaagcagttgccagatgcccagctcctgggccat
cgcttcctgctcaggaggaagttcatacctgaccctcaaggcaccaacctcatgttcgcc
ttctttgcacaacacttcacccatcagttcttcaaaacttctggcaagatgggtcctggc
ttcaccaaggccttgggccatggggtagatctcggccacatttatggggacaacctggaa
cgtcagtatcagctgcggctctttaaggatgggaagctcaagtaccaggtgctggacgga
gagatgtacccgccgtcggtggagaaggcgccagtgttgatgcactatccacggggagtt
ctgccccggagccagatggccgtgggccaggaggtgtttgggctgcttcccgggctcatg
ctttatgccacactctggctgcgtgaacacaaccgtgtgtgtgacctgctgaaggctgag
caccccacctggggtgatgagcaactcttccagaccgcccgcctcatcctcatcggggag
accatcaagattgtgattgaggagtacgtgcaacagttgagcggttacttcctgcggctg
aagtttgaccccgagctgctgttcagcgcccagttccagtatcgcaaccgtatcgccatg
gagttcaaccagctctaccactggcacccactcatgcctgactccttcaaggtgggctcc
caggactacagctacgagcagttcctgttcaacacctccatgctcgtggactatggggtc
gaggccctggtggacgccttctctcgccagagcgctggccggattggtgggggtagaaac
atagaccaccacgtcctgcacgtggctgtggaggccatcaaggaatcccgcgagctgcgg
ctgcagcccttcaatgagtaccgcaagaggtttggcatgagaccctacacgtccttccag
gagctcacaggggagaaggagattgcagctgagttggaagagctgtatggagacatcgat
gccttggagttctacccggggctacttctggagaagtgccatccaaactccatctttggg
gagagtatgatagaaattggggctcccttttccctcaagggcctcctagggaatcccatc
tgctctccagagtactggaagccaagcacattcggtggtgagatgggcttcaatatggtc
aagacagccacactgaagaagctggtctgcctcaacaccaagacttgcccctacgtttcc
ttccacgtgcccgacccccaccaggatggcgggcctggtgtggagcggccatccacagag
ctctga

DBGET integrated database retrieval system