KEGG   Amycolatopsis mediterranei S699: AMES_2569Help
Entry
AMES_2569         CDS       T02190                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
amm  Amycolatopsis mediterranei S699
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMES_2569
Enzymes [BR:amm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMES_2569
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMES_2569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2784672..2786480
Genome map
AA seq 602 aa AA seqDB search
MAEEARPDAALGLDGVPHTGEAMTADGMLVEPQAGDFRSAQQAPSNPEWFKGAVFYEVLV
RAFADSNGDGTGDLRGLAGRLDYLAWLGIDCLWLPPFYASPLRDGGYDISDFRAVLPEFG
SVEDFVFLLNEAHRRGIRVITDLVLNHTSDAHPWFQQSRSDPDGPYGDYYVWSDDDSRYA
DARIIFVDTETSNWTYDPVRGQFYWHRFFSHQPDLNFENVDVQNAMIDTLRFWLDLGIDG
FRLDAVPYLFEQEGTNCENLPRTHEFLKRCRKVVDDEYPGRILLAEANQWPSDVVEYFGD
PAVGGDECHMAFHFPLMPRIFMAVRRESRFPISEILTQTPTIPSGAQWGIFLRNHDELTL
EMVTDEERDYMYAEYAKDPRMKANIGIRRRLAPLLDNDRNQQELFTAMLLSLPGSPVLYY
GDEIGMGDNIWLGDRDAVRTPMQWTPDRNAGFSSCDPGRIYLPVIMDPVYGYQGLNVEAQ
SNNASSLLNWTRRMIEVRKQHHAFAEGEFVDLGGSNPSVLAYKRQWRRPDGGEDVVLCVN
NLSRFPQPVELDLSAHRGCTPVELTGGVRFPSIGDLSYLLTLPGHGFYWFQLTSPGDEGE
AR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaagcccggcccgacgcggcgttggggctggacggtgtgccgcacaccggt
gaggcgatgaccgccgacggcatgctggtcgaaccgcaggccggggacttccggtcggcg
cagcaggcgccgagcaacccggagtggttcaagggcgcggtgttctacgaagtgctggtg
cgcgcgttcgccgactccaacggcgacggcaccggcgatctgcgcggcctggccggccgg
ctcgactacctggcctggctgggcatcgactgcctgtggctgccgccgttctacgcctcg
ccgctgcgcgacggcgggtacgacatcagtgacttccgcgcggtgctgccggagttcggc
agcgtcgaggacttcgtcttcctgctcaacgaggcccaccggcggggcatccgggtgatc
accgacctggtgctcaaccacacctcggacgcgcacccgtggttccagcagtcccgcagc
gaccccgacggcccgtacggcgactactacgtgtggagcgacgacgactcgcgctacgcc
gacgcccggatcatcttcgtcgacaccgagacgtcgaactggacctacgatccggtgcgc
ggccagttctactggcaccggttcttctcccaccagcccgacctgaacttcgagaacgtc
gacgtccagaacgcgatgatcgacaccctgcggttctggctggacctgggcatcgacggg
ttccgcctggacgccgtgccgtacctgttcgagcaggagggcaccaactgcgagaacctg
ccgcgcacgcacgagttcctcaagcgctgccgcaaggtcgtcgacgacgagtacccgggc
cggatcctgctggccgaggcgaaccagtggccctcggacgtcgtcgagtacttcggcgac
ccggcggtcggcggcgacgagtgccacatggcgttccacttcccgctgatgccccggatc
ttcatggcggtgcggcgtgagtcccggttcccgatctcggagatcctcacccagaccccg
accatccccagcggggcccagtggggcatcttcctgcgcaaccacgacgagctgaccctc
gagatggtcaccgacgaagagcgcgactacatgtacgcggagtacgccaaggacccgcgc
atgaaggccaacatcggcatccgccgccggctggccccgctgctggacaacgaccggaac
cagcaggagctgttcacggcgatgctgctgtccctccccggttcgcccgttctgtactac
ggtgacgagatcggcatgggagacaacatctggctcggcgatcgcgacgcggtgcgaacc
cccatgcagtggaccccggaccgcaacgccgggttctcctcctgcgacccgggccgcatc
tacctgccggtgatcatggacccggtgtacggctaccagggcctgaacgtcgaggcgcag
tcgaacaacgcgtcttcgctgctcaactggacccgccggatgatcgaggtgcgcaagcag
caccacgcgttcgccgagggcgagttcgtcgacctcggcggctccaacccgagcgtgctg
gcctacaagcgccagtggcggcgcccggacggcggcgaagacgtcgtgctctgcgtgaac
aacctctcccggttcccgcagccggtggagctggatctgtccgcgcaccgcgggtgcacg
ccggtggagctcaccggcggcgtgcggttccccagcatcggggacctgtcgtacctgctg
acgctgcccgggcacggcttctactggttccagctgacgagcccgggagacgaaggcgaa
gcgaggtga

DBGET integrated database retrieval system