KEGG   Amycolatopsis methanolica: AMETH_5324Help
Entry
AMETH_5324        CDS       T03230                                 

Gene name
neu
Definition
(GenBank) neuraminidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
amq  Amycolatopsis methanolica
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:amq00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AMETH_5324 (neu)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AMETH_5324 (neu)
Enzymes [BR:amq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AMETH_5324 (neu)
Bacterial toxins [BR:amq02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AMETH_5324 (neu)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5487615..5489471
Genome map
AA seq 618 aa AA seqDB search
MRSFAAWRAVPLVAVLFASLLGGGVTASADTARPGFDQQSLFNPKQEQGYFCFRIPAIVK
STAGTLLAFAEGRVNDCGDAGDIDLVLKRSTDGGRTWSPLEVINSGDGDTHGNPVPIVDR
TTGRIVLITTYNAGRTDGKGCDVPCARPPHVQYSDDDGLTWSAPVDISAQASRPEWDAWY
ASGPVHGIQLTQGEHRGRLVFGVNAETAQGTDPVANHAALVYSDDHGATWHIGAVDSYPF
QAKGPFTQKPQEITVVELADGSIYAGGREQGGTDIGNRDYAISRDGGETFSQPFRTIPDL
VTPMVQGSLLRLDRPGPDRILFASPSDTDRRRWMMIRSSYDGGRSWENAEQGTRVTDEWS
GYSDMVQISDRSARTTEIGLMYEGGPVDARDEIRFARFTEDVLGWHNSAGPTTRDVSGER
SDAYLVGGPVPVPGRYGDALELDGVDDFVRVPYDSAQVVGDGDFTWTGWIRYGASTGNQV
FFWMGGMGSTAPQIWLRGEPAANRLIASMTTTAGTKQVTSAGAFNDQQWHHVALQRTGGQ
LLLFVDGVQVAAGPAAAGSVTERVSFQFWLGRRLDGGMGLDGALDDVRLYRKALSPSELD
AVRANAPVRDALALRLPF
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgttcgcagcgtggcgcgcggtcccgctcgtggcggtgctgttcgccagtctg
ctcggcggcggggtcaccgcctccgccgacaccgccagaccgggcttcgaccagcagtcg
ctgttcaaccccaagcaggagcagggttacttctgcttccgcatcccggcgatcgtcaag
agcaccgcgggcaccctgctcgcgttcgccgagggccgggtcaacgactgcggcgacgcc
ggtgacatcgacctcgtcctcaagcgctccaccgacggcggccggacctggtcaccgctg
gaggtcatcaactccggagacggcgacacgcacggcaacccggtcccgatcgtggaccgg
acgaccggccggatcgtcctgatcaccacctacaacgccggccgcaccgacggcaagggc
tgcgacgtgccgtgcgcccgcccgccgcacgtgcagtacagcgacgacgacgggctcacg
tggtccgcgccggtcgacatcagcgcgcaggccagcaggcccgagtgggacgcctggtac
gcctccggtccggtgcacgggatccagctcacccagggcgagcaccgcggccgcctggtg
ttcggggtgaacgcggagaccgcgcagggcaccgacccggtggccaaccacgccgcgctc
gtctacagcgacgaccacggcgcgacctggcacatcggcgcggtggacagctacccgttc
caggcgaagggcccgttcacgcagaagccgcaggagatcaccgtcgtggagctcgccgac
gggtcgatctacgccggcggccgagagcagggtggcaccgacatcggcaaccgcgactac
gcgatcagccgcgacggcggcgagaccttcagccagccgttccggacgatccccgacctg
gtcacgccgatggtgcagggctcgctgctgcgcttggaccggccggggccggaccggatc
ctgttcgcgtcgccgtcggacaccgaccggcgccggtggatgatgatccgctcgtcctac
gacggcgggcgcagctgggagaacgccgagcagggcacacgggtgaccgacgagtggtcc
ggctactcggacatggtgcagatcagcgaccggtccgcccgcacgaccgagatcggcctg
atgtacgagggcggcccggtcgacgcgcgcgacgagatccggttcgcccgcttcaccgag
gacgtgctgggctggcacaattcggccggcccgacgacgcgggacgtgtccggtgaacgg
tcggacgcctacctggtcggcggcccggttccggtgcccggccgctacggtgacgcgctg
gaactggacggcgtggacgatttcgtgcgcgtgccctacgacagcgcgcaggtggtcggc
gacggcgacttcacgtggaccggctggatccggtacggcgcgtcgacgggcaaccaggtg
ttcttctggatgggcggcatgggctcgaccgcgccgcagatctggctgcgcggtgaaccg
gcggcgaaccgcctgatcgcgtcgatgaccaccacggcgggcacgaagcaggtcacgtcg
gcgggcgcgttcaacgaccagcagtggcatcacgtggcgctgcagcgcaccggcggccag
ttgctgctgttcgtcgacggcgtgcaggtggcggccggcccggcagcggccggttcggtg
acggagcgggtgtcgttccagttctggctgggccgccgcctcgatggaggcatgggactg
gacggcgcgctggacgacgtccggctctaccgcaaggcgctgtcaccgtccgaactggac
gctgtgcgggcgaacgcccccgtgcgggacgccctcgcgctgcggctgccgttctga

DBGET integrated database retrieval system