KEGG   Acaryochloris marina: AM1_0948Help
Entry
AM1_0948          CDS       T00617                                 

Definition
(GenBank) glutathione S-transferase C-terminal domain protein, putative
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
amr  Acaryochloris marina
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:amr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AM1_0948
Enzymes [BR:amr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AM1_0948
Transporters [BR:amr02000]
 Other Transporters
  Pores ion channels [TC:1]
   AM1_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
916860..917561
Genome map
AA seq 233 aa AA seqDB search
MISFYYAKPSLFSRPVWITLLEKDLKFEPIYVNMGGDQFTPEFRALNPFCRIPVLVDNGL
TITESQAILDYLDLQYPQPKLLPPSAQAVAKVRQVQMIAVNELVPAIGECLMKKPDQQTY
AKHRAVTVLNMFEGLLEAPYFGGDGLSLADIVTGSLVPVLGDLGFTLDQQPKLQRWLQVL
MARPAWQQTQLSAPEKDRFMRSIRALAKLWQKRRRQRADALLVPKKNTPPTIS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatttctttctattatgccaagccatccctctttagccgtcctgtctggatcacgctc
cttgagaaggacctaaagtttgagccgatatacgtcaacatggggggagatcaattcact
ccagaattcagagccctcaatcccttttgtcggattccggtactagtggacaatggtttg
acgattacagagtcccaagccattttggattacttggacctgcaatatccccagcccaag
ttgctgcccccctctgcccaggcagtggccaaagtacgacaggtgcaaatgattgctgta
aatgaattggtcccagcgattggagagtgcttgatgaaaaagccagaccaacaaacctat
gccaaacatcgggcagtgacggtgctgaatatgtttgaagggcttctagaagccccctat
tttggtggcgatggtttaagtttggcggatattgtgacaggctcgttagtcccggtactc
ggtgacttaggatttaccttggatcaacagccaaagctacagcgctggctccaagtgctg
atggccagacctgcttggcaacagactcaattatctgcacctgagaaagatcggtttatg
cgaagtattcgggccttggccaaactatggcaaaagcggcgccgccagcgggctgatgca
ttactcgttcccaaaaaaaacactcccccaaccattagttaa

DBGET integrated database retrieval system