KEGG   Actinoplanes missouriensis: AMIS_3580Help
Entry
AMIS_3580         CDS       T01795                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ams  Actinoplanes missouriensis
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ams00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AMIS_3580
Enzymes [BR:ams01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMIS_3580
DNA repair and recombination proteins [BR:ams03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AMIS_3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
374624..375553
Genome map
AA seq 309 aa AA seqDB search
MKTPDRFVVTVEGRDLELSNLDKVMYPAAGFTKGEVIDYYTRIAPVMLPHLRDRPATRIR
FPNGVDGMHFFEKNKPGGTPDWVRLETLPVPGSTKSRETIEFVVVDDLPTLVWLANLAAI
ELHTPQWRIGADPDLMVVDLDPGAPAGLRECCAVATLMRDRLAADGIDAYPKTSGKKGMQ
LCCPISGTQDSEVVSAYAKKVADELAAMVPGSITAKMAKAIRPGKIFIDWSQNAAAKTTV
TPYSLRAGEGPTGSAPLTWDEVIAMATGEVEARQFGAGEVLERVEEHGDLMAALSEPGPA
VPVSYRRRS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgcctgaccggttcgtggtcaccgtcgagggacgcgacctcgagctgtccaac
ctcgacaaggtgatgtacccggcggccggattcaccaagggcgaagtgatcgactactac
acccggatcgccccggtcatgctgcctcacctgcgcgatcgcccggccacccggatccgc
ttccccaacggcgtcgacggcatgcacttcttcgagaagaacaagcccggaggtacgccg
gactgggtgcgcctggagaccctgccggtgcccggttccaccaagagccgggagaccatc
gaattcgtggtcgtcgacgacctgcccacgctcgtctggctggcgaacctggccgcgatc
gaactgcacaccccgcagtggcggatcggcgccgacccggacctgatggtggtcgacctg
gacccgggagcgccggccgggctgcgggaatgctgcgcggtggcgaccctgatgcgggac
cggctcgccgccgacgggatcgacgcctatccgaagacgtccgggaagaagggcatgcaa
ctgtgctgcccgatctccggcacacaggactccgaggtggtctccgcgtacgcgaagaag
gtcgccgacgaactggcggcgatggtccccggctcgatcaccgcgaagatggccaaggcg
atccggcccggcaagatcttcatcgactggagccagaacgcggcggcgaagacgacagtg
acgccgtattcgctgcgggcgggggaggggccgaccggttcggcgccgctgacctgggac
gaagtgatcgcgatggcgaccggggaggtggaggcgcggcagttcggggcgggcgaggtg
ctggagcgggtcgaggagcacggtgatctgatggcggcgctgtccgaacctggccccgcc
gtgccggtgtcgtatcgacgtaggtcgtga

DBGET integrated database retrieval system