KEGG   Acidiphilium multivorum: ACMV_08240Help
Entry
ACMV_08240        CDS       T01446                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
amv  Acidiphilium multivorum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_08240 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_08240 (rbcL)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ACMV_08240 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(931792..933057)
Genome map
AA seq 421 aa AA seqDB search
MSGAERIEADYLIETAFDPGHAAAAMAGEQSSGTFVPVPGETPELKARAAARVERLDVLE
TVGSPSLPGAGTPRGASPPVIRRAAVTLSWPVDNLGPSLPNLVATVAGNLFELRQFSGLR
LLDLRLPASFAAANPGVRFGIPGTRRLAGVEGRPLIGTIVKPSVGFDAGQTAALVATLCE
AGIDFIKDDELQADGPACPFEARARAVMRVVNDHAERTGKKVMFAFNLTGEVDEMRRRHD
LVRELGGTCVMASLNSVGVSGFLALSRHAALPVHAHRNGWGALSRHPLLGWSYVAWQKIW
RLAGADHMHVNGLRNKFSEDDDSVIASARACLTPMSDAAPNVVMPVFSSGQSVRQAGDTY
AALGSADLIYAAGGGIMGHPGGPAEGVAALRAAWDAAMAGIPAAEHAKTHPALARALEGA
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcgcggaacgcatcgaagccgattacctgatcgagaccgcgttcgaccccggc
cacgccgccgcggcgatggccggcgagcagtcgagcggcaccttcgtgccggtgcccggc
gaaacccccgaactcaaggcgcgcgccgcggcacgggtcgagcggctcgatgtcctggaa
acggtcggctcgccctccctgcccggcgccggaaccccgcgcggcgcgtcgccgccggtc
atccgccgcgccgccgtcaccctttcctggccggtggacaatctcggcccgtcgctgccc
aatctcgtcgcgaccgtcgccggcaatctcttcgaactgcgccagttctccggcctgcgc
ctgctcgacctgcggctgcccgcgagcttcgccgccgccaatcccggcgtgcgcttcggc
atccccggcacgcggcggcttgccggcgtcgaggggcggccgctgatcggcaccatcgtc
aagcccagcgtcggcttcgatgccgggcagaccgcggcgctggtcgccaccctctgcgag
gccggcatcgacttcatcaaggacgacgagttgcaggccgacggccccgcctgcccgttc
gaggcccgcgcccgcgcggtgatgcgcgtcgtcaacgatcatgccgagcgaaccggaaag
aaggtgatgttcgccttcaacctgaccggcgaggtcgacgagatgcgccgccggcacgac
ctcgtgcgcgagctcggcggcacctgcgtgatggcgagcctcaattccgtgggcgtcagc
ggcttcctcgcgctgtcgcgccacgccgcgctgccggtccacgcgcatcgcaacggctgg
ggcgcgctgtcgcggcacccgctgctgggctggtcctatgtcgcctggcagaagatctgg
cgcctcgccggcgccgaccacatgcatgtgaacggcctgcgcaacaagttctccgaggat
gacgacagcgtcatcgcctccgcgcgcgcctgtctcaccccgatgtccgacgcggcgccg
aacgtcgtcatgccggtcttctcctccggccagtcggtccgccaggcgggcgacacctac
gcggcgctcggctcggccgacctgatctacgccgccggcggcggcatcatgggccatccc
ggcgggccggccgaaggcgtggcggccttgcgcgcggcgtgggacgcggcgatggcgggc
attcccgccgccgagcacgcgaagacgcacccggcgctggcccgggcgctggagggcgcg
tcctga

DBGET integrated database retrieval system