KEGG   Acidiphilium multivorum: ACMV_10880Help
Entry
ACMV_10880        CDS       T01446                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amv  Acidiphilium multivorum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_10880 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_10880 (cbbS)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ACMV_10880 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(1230466..1230894)
Genome map
AA seq 142 aa AA seqDB search
MRLTQGCFSFLPDLTDEQISRQIQYCLDKGWAVNLEYTDDPHPRNTYWEMWGLPMFDIRD
AKAIMSELADCRRIHDDCYIRLSAFDATNTWESLRISFIVQRPKDEPGFMLTRSEAAGRT
MRYETRAYVVQKPEGARYGNSG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacccagggctgcttttcgtttcttcccgatctgaccgatgaacagatcagc
cgccagatccagtactgcctcgacaagggctgggcggtgaacctcgaatataccgacgac
ccgcacccgcggaatacctactgggaaatgtggggcctgccgatgttcgacatccgcgat
gccaaggcgatcatgtccgaactcgcggactgccggcggattcacgatgattgctatatc
cgcctctcggcgttcgacgccaccaacacatgggagtcgctccgcatttccttcatcgtg
cagcggccgaaggacgaacccggcttcatgctgacacggagcgaggccgccggccgcacc
atgcgctacgaaacccgcgcctatgtcgtccagaaacccgaaggcgcgcgctatggaaat
tccgggtga

DBGET integrated database retrieval system