KEGG   Acidiphilium multivorum: ACMV_10880Help
Entry
ACMV_10880        CDS       T01446                                 

Gene name
cbbS
Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
amv  Acidiphilium multivorum
Pathway
amv00630  Glyoxylate and dicarboxylate metabolism
amv00710  Carbon fixation in photosynthetic organisms
amv01100  Metabolic pathways
amv01120  Microbial metabolism in diverse environments
amv01200  Carbon metabolism
Module
amv_M00165  Reductive pentose phosphate cycle (Calvin cycle)
amv_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
amv_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ACMV_10880 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ACMV_10880 (cbbS)
Enzymes [BR:amv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ACMV_10880 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAJ80435
NITE: ACMV_10880
UniProt: F0IX25
LinkDB All DBs
Position
complement(1230466..1230894)
Genome map
AA seq 142 aa AA seqDB search
MRLTQGCFSFLPDLTDEQISRQIQYCLDKGWAVNLEYTDDPHPRNTYWEMWGLPMFDIRD
AKAIMSELADCRRIHDDCYIRLSAFDATNTWESLRISFIVQRPKDEPGFMLTRSEAAGRT
MRYETRAYVVQKPEGARYGNSG
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagactgacccagggctgcttttcgtttcttcccgatctgaccgatgaacagatcagc
cgccagatccagtactgcctcgacaagggctgggcggtgaacctcgaatataccgacgac
ccgcacccgcggaatacctactgggaaatgtggggcctgccgatgttcgacatccgcgat
gccaaggcgatcatgtccgaactcgcggactgccggcggattcacgatgattgctatatc
cgcctctcggcgttcgacgccaccaacacatgggagtcgctccgcatttccttcatcgtg
cagcggccgaaggacgaacccggcttcatgctgacacggagcgaggccgccggccgcacc
atgcgctacgaaacccgcgcctatgtcgtccagaaacccgaaggcgcgcgctatggaaat
tccgggtga

DBGET integrated database retrieval system