KEGG   Nostoc sp. PCC 7120: all0070Help
Entry
all0070           CDS       T00069                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ana  Nostoc sp. PCC 7120
Brite
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     all0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(74146..74958)
Genome map
AA seq 270 aa AA seqDB search
MKSSLWQRFIGFFMVILVTSMLYACQPQEAANSLPTNVASPVQTTTPTTDKRSIGFIDRQ
LGTNPAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEAL
LRDLNSVPEDIRTTVRNNGGGHLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKK
QFNQAGGDRFGSGWVWLVRNPQGQLQIVSTPNQDSPIMEGSYPIMGNDVWEHAYYLRYQN
RRPEYLNNWWNVVNWSEINRRTQASRQSNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatctctgtggcaacggtttattggctttttcatggtcattctagtgacatct
atgctttatgcttgccaacctcaagaagcagcaaattccctgccgactaacgtagcaagt
cctgtacaaaccactacgcccacaacagataaacgttccataggttttatcgatcgccaa
ctgggtacaaatccagccgagttaccaccattaccttacggttatgatgccctagagaaa
gcgattgatgcagaaaccatgaaactgcatcacgataaacaccatgcagcatacgttaat
aaccttaacaatgctttgaagaagcatccagaactgcaaaatagtagtgtagaagcttta
ctacgggatttgaacagtgtacctgaagatattcgcacaacggtacgtaacaatggtggc
ggacatctcaaccatacaattttctggcaaatcatgagtcctgatgggggtggacaacca
acaggagacatcgcccaagaaatcaaccaaacctttggcagttttgaagagttcaaaaaa
cagtttaaccaagcaggaggcgatcgctttggtagtggttgggtttggttagtgcgaaat
ccccaaggacagttacagattgtcagcactcccaatcaagatagccctatcatggaaggt
tcatacccaatcatggggaatgatgtctgggaacacgcttattacctcagatatcaaaac
cgtcgtcctgagtatttaaataactggtggaatgtagttaattggtcagaaattaacaga
cgcacccaagcttcacggcaaagtaattcttaa

DBGET integrated database retrieval system