KEGG   Nostoc sp. PCC 7120: all4861Help
Entry
all4861           CDS       T00069                                 

Gene name
pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    all4861 (pepC)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    all4861 (pepC)
   00680 Methane metabolism
    all4861 (pepC)
Enzymes [BR:ana01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     all4861 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(5788301..5791249)
Genome map
AA seq 982 aa AA seqDB search
MVDLLRQLRDLCSPEGQATKDQAVSAVKLIEQLNINEAIRAARAFALYFQLINIIEQEYE
QRQQLTRYSDLEAETAPLNGSENITSSSNHNEDDVIFNRGLGTDFLGKNWTNRGQGKQKG
TFAALFPLLSKLNVPPQQIQRLISQLDVRLVFTAHPTEIVRHTIRDKQRQVVDLLQQLDE
VENRAKDGGGYPWEAGEIREKLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDG
IPQLYKRFKYALNQTFSWLEPPSKDFCSFGSWVGSDRDGNPSVTPEITWQTACYQRKMVL
ERYIKSVTQLIELLSISMHWSDVLPDLLESLELDQSQLSEVYDALALRYRQEPYRLKLAY
VLKRLENTRDRNLALYKGETPTNEDSPMYRSGSEFLAELRLIQHNLTETGLSCRELDNLI
CQVEIFDFNLTKLDIRQESTRHSDALNEILDYLQLLPQPYNDLSEEQRVAWLTTELQTRR
PLISSELPFSDKTNDVIKTFRVVRSLQQEFGINICQTYIISMCRQVSDVLEVLLLAKEAR
LFDPAIAVGTIQVVPLFETVEDLQRSRSVMRQLFELPLYRALLAGGYKNTEVKVPNTELT
PQSPAPSPQSVLTPDLQEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQQIAEEYGVNLRIF
HGRGGSVGRGGGPAHEAILAQPGHSINGRIKITEQGEVLASKYSLLDLALYNLETITTAV
IQASLLRTGFDDIEPWNEIMEELAARSRQHYRGLIYEQPDFIDFFHQVTPIEEISQLQIS
SRPARRPSGKKDLSSLRAIPWVFSWTQTRFLLPSWYGVGTALQEFFNEEPEEHLKLMRYF
YVKWPFFKMVISKVEMTLAKVDMQMAGHYVQELSDPEDKPRFEKVFEQIANEYYLTRDLV
LKITDHGRLLDGDPVLQRSVQLRNGTIVPLGFIQVSLLKRLRQSKNNTATSGVIHSRYSK
GELLRGALLTINGIAAGMRNTG
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggtggatttgttacggcagttgcgtgatttgtgttcaccagaagggcaagccacaaaa
gaccaagcagtttctgctgtcaagttaattgaacagttgaatattaatgaagccattcgg
gcagctagggcttttgctttgtattttcagctgatcaacatcatagagcaggaatatgag
caaaggcagcaattaactcgctattctgacttagaagcggaaacagcacccctaaatggt
tccgaaaacattacctcatcctctaaccacaacgaagatgatgttattttcaaccggggt
ttagggactgatttcttaggaaaaaattggactaatcgtggacaagggaaacaaaaaggt
acttttgcagcgttatttcccttattgtctaaattgaatgtcccaccccaacaaattcaa
cgcctgatttcccaactagatgtccgtttggtattcactgcccacccaacggaaattgtc
cgccacaccattcgggacaaacaacggcaagtagtagatttgttgcaacaactcgatgag
gtggaaaatcgagctaaggacggcggcggctatccttgggaagcgggggaaattcgggaa
aaattgctagaagaaattcgcttgtggtggcgtacagacgaactccaccagtttaagccc
actgtgctggatgaagtggattatgctttgcattacttccaagaagttttatttgatggg
attccccaactgtataagcgtttcaaatacgccctaaatcaaactttctcctggttagaa
ccaccaagcaaagatttctgttcctttggttcttgggtaggttcagacagagatggtaat
ccatcggtaacaccggaaattacctggcagacagcttgttatcagcgcaaaatggtgctg
gaaagatatatcaagtctgtcacccaattgattgaattattaagtatctccatgcactgg
agtgacgttttaccagacttattggaatccttggagttagatcagtcccagttaagtgaa
gtatacgatgctctggcgctgagatatcgccaagaaccctatcgtctcaaactagcttac
gtcctcaagcgcctggaaaatacccgcgatcgcaatttagctttatataaaggtgaaacc
cccacaaatgaagatagccccatgtatcgttcggggtcggaatttttggcggaactgcga
ttaattcagcataacttgacggaaacaggtttaagctgccgagaattggataatttgatc
tgtcaagtggaaatttttgactttaacctgacaaaattagacatccgtcaagaatccacc
agacattcggacgcgttaaacgagattctcgactatctccaattattaccccagccatac
aacgacctctccgaagaacagcgagttgcttggctaacaaccgaactgcaaacccgtcgc
ccattaatttcgtcagaactaccattctctgacaaaactaatgatgtcattaaaactttc
cgcgtagtgcgatcgctccaacaagaatttggcattaatatctgccaaacttacatcatt
agtatgtgtcgtcaagtcagcgatgtcttagaagttttgcttctagccaaagaagccaga
ctttttgacccagcgatcgccgtcggtacaattcaggttgtaccattatttgagactgtc
gaagatttacaacgttctcgcagcgtcatgcgacagttatttgaattacctctataccgc
gctttgctagctggtggttacaaaaataccgaagtaaaagtaccgaatactgagctaaca
ccccaatccccagcccccagtccccagtccgtactcacccccgacttacaagaagtcatg
ctgggatattccgacagcaacaaagactccggcttcttgagtagcaattgggaaattcat
aaagcccaaaaatcattacagcaaatcgccgaagaatatggcgtaaatttgcggattttc
cacgggcgcggcggttctgtaggacgaggcggcggcccagcccacgaggcgattttggct
caaccaggacacagcatcaacgggcggattaaaattaccgaacaaggggaagtattagcc
tccaagtactccttgctagatttagccctgtacaacttggaaaccatcaccacggcggtg
attcaagccagcctcctgcgaactgggtttgatgatatcgaaccttggaacgaaattatg
gaagaattagcagcgcgatcgcggcaacattatcgtggtttaatttacgaacagcctgat
ttcattgactttttccaccaagtcacacccattgaagaaatcagtcaactacaaattagt
tctcgtcccgcccgtcgtccttctggtaagaaagatttaagcagtctccgcgccattcct
tgggtatttagctggacacaaacacgattcttactaccttcttggtacggtgtcggtaca
gctttacaagaatttttcaacgaagaaccagaagaacatctcaaattgatgcgctacttt
tatgtcaagtggcctttcttcaagatggtgatttctaaagtagaaatgaccttggcgaaa
gtagatatgcaaatggctggtcactacgtacaagaattgtctgaccctgaagacaaaccc
cggtttgagaaagtatttgagcaaatcgccaacgaatattatctcaccagagatttagtc
ttaaaaatcaccgaccacggtcggcttttagatggtgatcctgtactccagcgttctgta
cagttacgcaatggtacaatcgtcccactagggtttatccaagtttccctcctcaagcgc
ctacgccagtccaaaaataatactgcaacctctggtgtcattcactctcgttacagtaag
ggagaattattgcgcggcgcactgttaaccattaatggtattgccgcagggatgagaaat
acaggttga

DBGET integrated database retrieval system