KEGG   Nostoc sp. PCC 7120: alr1524Help
Entry
alr1524           CDS       T00069                                 

Gene name
rbcL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    alr1524 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    alr1524 (rbcL)
Enzymes [BR:ana01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     alr1524 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
1785970..1787400
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKSGYKAGVQDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPFEEAAAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQFIAYIAYPLDLFEEGSITNVLTS
IVGNVFGFKALRALRLEDIRFPVAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSAPFQRWRDRFLFVADAITKAQAETGEIKGHY
LNVTAPTCEEMLKRAEYAKELKQPIIMHDYLTAGFTANTTLARWCRDNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKALRLSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASLPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLAREGNDVIREAAKWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagacaaaatctgggtataaagccggggttcaagat
tacagactaacttattacacacctgattacacacctaaagatacagatattctggcggcg
ttccgtgttacaccccagcccggagttccctttgaggaagcggctgcggctgtagcggct
gagtcttctactggtacttggacgaccgtatggacagacctgttaaccgatctagatcgt
tacaaaggtcgttgctacgatatcgaaccagttcccggcgaagacaaccaattcattgcc
tacatcgcttatcctttggatctgtttgaagaaggctccatcaccaacgttttgacctca
attgtaggtaacgtatttggttttaaagcattacgcgcattgcgtttggaagacattcgc
tttcctgttgcttacatcaagaccttccaaggccctcctcacggtatccaagttgagcgt
gacaaattaaacaaatatggtcgtcctctgttgggttgtaccatcaaaccaaaattaggt
ctgtctgctaagaactacggacgcgctgtatacgagtgtttgcgcggtggtttggacttc
accaaagacgacgaaaacattaactccgcaccattccaaagatggcgcgatcgcttcttg
tttgtagctgatgctatcaccaaagcacaagcagaaacaggcgaaatcaaaggtcactac
ctaaacgtgaccgctcctacctgtgaagaaatgctaaaacgggctgagtacgctaaagaa
ctcaaacagcccatcatcatgcacgactacctgaccgcaggtttcacagctaacaccacc
ttggctcgttggtgtcgtgacaacggcgttctactgcacatccaccgcgcgatgcacgca
gtaatcgaccgtcaaaagaaccacggtatccacttccgtgtattggctaaagccctacgt
ctatctggtggtgaccacatccacaccggtaccgtagtaggtaaattggaaggtgaacgc
ggtatcacaatgggcttcgttgacctactacgtgaaaactacgttgagcaagacaagtct
cgcggtatttactttacccaagactgggcttctctacctggtgtaatggcagttgcttcc
ggtggtatccacgtatggcatatgccagcgttggtagaaatcttcggtgatgactccgta
ctacaattcggtggtggtacactcggacacccttggggtaacgctcctggtgcaaccgct
aaccgtgtagctttggaagcttgcgtccaagcacgtaacgaaggtcgtaacttggctcgt
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgaattggctgtcgcttgc
gaactgtggaaagaaatcaagttcgagtttgaggcaatggataccgtctga

DBGET integrated database retrieval system