KEGG   Nostoc sp. PCC 7120: alr2190Help
Entry
alr2190           CDS       T00069                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    alr2190
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     alr2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
2632724..2634202
Genome map
AA seq 492 aa AA seqDB search
MAQMNGTMMQYFHWYIPNDGNLWSKVEASAPELADAGFTAMWLPPAYKGFAGSFDVGYGV
YDLFDLGEFDQKGSVRTKYGTRQQYLDAVKSLQTHGLQVYADAVLNHKMGGDAVETPKAT
PFPQDDRLNPKGGLQDIKTYTHYNFPGRQGKYSNFEWHWWHFDAVDYNEYNSGDRSTVYL
LEGKNFDDYVALEKGNFAYLMGCDLDFQNEWVRGEVTYWGKWCLDTTKVDGFRIDAIKHI
STWFFPEWIDALERHAGKDLFMVGEYWYNDINTLLWYVDAVRGKMSVFDVPLHYNFHQAS
KSGGNYDMRRILDGTMMQQRPTHAVTFVENHDSQPLQALESVVEPWFKPLAYAIILLRQE
GYPCVFHADYYGAEYEDWGKDGNRYNIFMPSHRWIIDKLLYARKHYAYGPQYNYLDHWNT
IGWTRLGDADHPQGMAVIMSDGSEGIKWMEVGKPNTKFIDLTEHIKEAVYTNEWGWGEFR
CLGGSVSVWVQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcacagatgaatggcacaatgatgcaatacttccactggtacatccctaacgatggg
aacttgtggagtaaagttgaggcttcagcaccagaattagcagatgcaggttttacagcc
atgtggctaccaccagcctacaagggctttgctgggtcgtttgatgtgggatatggtgtt
tacgacttatttgatttaggtgagtttgatcaaaaaggctcggtgcggacgaaatatggt
acacgtcagcagtatcttgatgcggttaaatctctgcaaacccatggtctacaagtttat
gctgatgcggtactaaatcataagatgggtggtgatgcagtagaaacaccaaaagccact
ccttttcctcaagacgatcgcctgaatcctaaaggtgggttacaagatattaagacctac
actcattataatttccctggacggcaaggcaaatattctaactttgagtggcattggtgg
cattttgatgctgttgattataacgaatataacagtggcgatcgcagcacagtttactta
ttagaaggtaaaaactttgacgactacgtagccttagaaaaaggcaactttgcctatttg
atgggttgtgatctggattttcaaaatgagtgggtgcgcggtgaagttacttactggggt
aagtggtgtcttgacactacaaaagtagatggtttccgcatcgatgctattaaacatatt
tccacatggttctttcctgaatggatagatgcactagaacgccatgctggtaaagattta
tttatggtaggagagtattggtataacgatattaatactctgctttggtatgttgatgct
gttcgtggcaaaatgtcagtttttgacgtaccactacattacaacttccatcaagccagc
aaatctggaggcaattatgatatgcgccggattttggatggcacaatgatgcaacaacgt
cctacccatgctgtgacatttgtcgaaaatcatgattctcagcctttgcaagctttggaa
tctgtcgttgaaccttggtttaaacccttagcttacgccattattttgttacgacaagaa
ggctatccttgtgtctttcatgctgactactacggtgcagagtatgaagactgggggaaa
gatggcaatcgttacaatatttttatgccgtcccaccgttggataattgataagttactt
tatgcacgtaaacattatgcttatgggccacaatacaattatttagaccattggaatact
attggttggacacgcttaggtgatgcagatcatcctcaaggaatggctgtgattatgagt
gatggttcagaaggtattaaatggatggaagttggtaaacccaatactaagtttattgac
ttaactgaacatatcaaagaagctgtatataccaatgaatggggctggggtgaatttcgt
tgtctaggcggttcagtatctgtttgggtgcaagcgtaa

DBGET integrated database retrieval system