KEGG   Anabaena sp. 90: ANA_C10606Help
Entry
ANA_C10606        CDS       T02341                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
anb  Anabaena sp. 90
Brite
Enzymes [BR:anb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ANA_C10606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
chANA01:648646..649248
Genome map
AA seq 200 aa AA seqDB search
MAFTQLALPFASDALESYGMKAETFEYHYGKHHKAYVDNLNKLVDGTELANKSLEEVIQI
AFGDSAKAGIFNNAAQVWNHSFFWNCLKPAGGGAPTGALAAKIEQDFGSFEKFKEEFSTA
AATQFGSGWAWLVDDGGTLKVMKTPNAENPLAHGKKALLTIDVWEHAYYIDFKNARPGFI
KNFLDNLVNWDFVAENFAKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacccaactagctttaccttttgcttctgatgctttagaatcctatggcatg
aaagcggaaacctttgaatatcactatggtaagcatcataaagcttatgtagataatttg
aataagcttgttgatggtacagaattagctaataagtctttggaagaagtaattcaaatt
gcttttggtgactctgctaaggctggaatcttcaacaatgcggctcaagtttggaatcac
tctttcttctggaattgcttgaaaccagcaggtggcggcgcacctacaggcgcattagca
gctaaaattgaacaggattttggtagctttgagaaattcaaagaggaattttctactgct
gctgcaactcaattcggtagtggttgggcttggttggttgatgatggtggcacactcaag
gtaatgaaaacccctaacgccgaaaacccccttgcacatggtaaaaaagcattgcttacc
attgatgtttgggaacacgcatattacattgacttcaaaaatgctcgtcctggattcatc
aagaatttcttagataatttggtgaactgggattttgtcgctgaaaattttgcaaaagct
taa

DBGET integrated database retrieval system