KEGG   Altererythrobacter namhicola: A6F65_02258Help
Entry
A6F65_02258       CDS       T04447                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
anh  Altererythrobacter namhicola
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:anh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A6F65_02258 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A6F65_02258 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A6F65_02258 (ddlB)
Enzymes [BR:anh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A6F65_02258 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:anh01011]
 Precursor biosynthesis
  Amino acid ligase
   A6F65_02258 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2264995..2265963)
Genome map
AA seq 322 aa AA seqDB search
MSLDRKLHVAVLMGGWANERPVSLMSGDGVADALEGKGHKVTRIDMDRQVAARIAEAAPD
VVFNALHGVPGEDGTVQGMLDLMGVPYTHSGLATSVIAIDKELTKQALVPAGIPMPEGTI
VKSADLFEGDPIPRPYVLKPVNEGSSVGVAIVTDDSNYGNPIARDAEGPWQQFETLLAEP
YIRGREMTTAVMAGPDGPRALAVTELVPKSGFYDFDAKYTDGMTDHVCPAEIPDDIAALC
REYALKAHEVLGCRGTSRTDFRWDDERGADGLFVLETNTQPGMTPLSLVPEQAKYCGIDY
PDLVEAIIADALAHFAPEGQGG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgaccggaaactccacgttgcagtcctgatgggtggctgggcgaacgaacgc
cccgtttcgctgatgagcggcgatggcgtggccgatgcgctggagggcaagggccacaag
gtcacgcggatcgacatggaccggcaggtcgccgcgcgcattgcagaggctgcgccggat
gtagtgttcaacgcgctgcacggcgtgcccggagaagatggcacggtgcagggcatgctg
gacctgatgggcgtgccctatacgcattccggcctcgccacctccgttatcgcgatcgac
aaggagctgacgaagcaggccctggtccccgcaggcatcccgatgccggaagggaccatc
gtgaagagcgcggaccttttcgaaggcgacccgatcccgcggccttacgtgctgaaaccg
gtcaacgaaggctccagcgtgggcgtcgccatcgtcacggatgacagcaattacggcaat
cccatcgcccgcgatgcggaggggccgtggcagcaattcgaaacgctgctcgccgagccg
tacattcgcggccgcgagatgacgacggcggtaatggccggcccggacggtccgcgcgca
ctggcggtgacggagctcgttcccaagagcggcttttatgatttcgatgccaagtacacg
gatggtatgaccgaccatgtctgcccagccgagatcccggacgacatcgctgccctgtgc
cgcgaatatgcgctgaaagcgcatgaagtgctcggctgccggggcacgagccgcacggac
ttccgctgggatgacgagcgcggggcagatggcctcttcgtgctggaaaccaatacgcag
ccgggcatgacgccgctcagcctcgtgcccgaacaggcgaaatattgcggcatcgattat
ccggacctcgtcgaggcgatcatcgccgatgcgctggcgcatttcgcgcctgaagggcag
ggcggctga

DBGET integrated database retrieval system