KEGG   Anoxybacillus sp. B2M1: GFC28_3260Help
Entry
GFC28_3260        CDS       T04370                                 

Definition
(GenBank) putative protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
anm  Anoxybacillus sp. B2M1
Brite
Enzymes [BR:anm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GFC28_3260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3247670..3248491)
Genome map
AA seq 273 aa AA seqDB search
MIQVKSSIVDNQFFSHSPLSKEQTMIFQTLLKERKKYTYKNEQQLLFELKLREQILHTAI
RLAKSKARFTIFRFSRCNEQFWSRNHLGGFELKKNVTPADGINDIFENSQLYAFECATAI
VIIFYKAVLDTIDRQTFNQLFANLLLYDWHYDEDLGVQTKTGNDYIPGDCLYFKNPDVDP
EMPQWQGENTIYLGGDLYYGHGIGIKTKDEIISALNKRRKKAAKKSAYLLEQTTRVDFKY
LSRFANSEQRIALPFDPSHLFIGKIGSSTFLNL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagttaaaagctccattgtggataaccaatttttttcccattcgcctttatct
aaagaacaaaccatgatttttcaaactttactaaaagaaagaaaaaaatacacatataaa
aatgaacaacagcttctatttgagctgaagctacgagaacaaattcttcatacggctatt
cgcttagcaaaaagtaaagcacgatttaccattttccgtttttcaagatgtaatgaacag
ttttggtcacgaaaccatttaggcggatttgagttaaaaaagaatgtgactccagctgat
gggattaatgatatttttgaaaacagccagctatacgcctttgagtgtgcaacagctatt
gtcatcattttctataaggcagtcttagatacgattgaccggcaaacttttaatcagctg
ttcgccaaccttcttttatacgattggcattatgacgaagatttaggagtacaaacaaaa
accgggaacgactacattcccggcgattgtctatattttaaaaatcctgatgtcgatcca
gaaatgcctcaatggcaaggagaaaataccatttacttaggaggagatctttattatggg
catgggatcggaatcaaaacaaaggatgaaattatttcagcactcaataaacggcgaaaa
aaagcagcgaaaaagtcagcttacttattagaacaaacaacaagagtagattttaaatat
ttaagcaggtttgcaaatagcgagcagcgcatagctttgccattcgatccaagccatctg
ttcattgggaaaatcggttcatccactttcttgaatttgtaa

DBGET integrated database retrieval system