KEGG   Anoxybacillus sp. B2M1: GFC28_3411Help
Entry
GFC28_3411        CDS       T04370                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
anm  Anoxybacillus sp. B2M1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:anm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GFC28_3411 (pfkA)
   01230 Biosynthesis of amino acids
    GFC28_3411 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GFC28_3411 (pfkA)
   00030 Pentose phosphate pathway
    GFC28_3411 (pfkA)
   00051 Fructose and mannose metabolism
    GFC28_3411 (pfkA)
   00052 Galactose metabolism
    GFC28_3411 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GFC28_3411 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GFC28_3411 (pfkA)
Enzymes [BR:anm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GFC28_3411 (pfkA)
Protein phosphatases and associated proteins [BR:anm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GFC28_3411 (pfkA)
Messenger RNA biogenesis [BR:anm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GFC28_3411 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3402954..3403913
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGLEVFGIYHGYAGLIEGKIKKLEIGDVGDI
IHRGGTMLYTARCPEFKTLEGQLKGIEQLQKHGIEGLVVIGGDGSYQGAKKLTEHGYPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMNDIVARLKRGHERGKKHSIIIVAEGVGSGVEFGSKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGQGGRCVGIQNNQLVDHDIIEAL
SHKHTIEPKMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaataggtgtgttaacaagcggcggcgattcaccaggaatgaatgcggcgatt
cgtgcagttgtgcgtaaagccatttatcacggattagaggtttttggtatttaccacggg
tacgcaggactcattgaaggaaaaattaagaaactagaaatcggcgatgtaggggatatt
attcatcgcggaggaacgatgctttataccgcacgctgcccggaatttaaaacacttgag
ggacaactaaaaggaattgaacagttgcaaaagcatggaatcgaagggctggttgttatt
ggcggagacggttcctatcaaggggcaaaaaagcttaccgaacacggatacccatgtgta
ggggtgccgggaacaatcgataatgatatacctggaacggattttacaatcggttttgat
acagcgttaaataccgtgattgatgcaatcgacaaaattcgtgatacagctacctctcat
gaacgcacatatgtgattgaagtcatgggacgtcatgctggcgatatcgcgctttgggcg
gggctggcaggcggtgctgaatcgattttaatcccagaagcagactatgatatgaatgat
atcgtcgcccgtttaaaacgaggacatgaacgcgggaaaaaacatagtattattattgtc
gcagaaggcgtcggaagcggagtcgaattcggcagcaaaattcaagaggcgaccgggttt
gaaacgcgtgtaacggtattgggacatgtacagagaggcggttctccgaccgcattcgat
cgcgtattagcaagccgtttaggagcgcgcgcagtcgagctgctgcttgaaggacaaggg
ggccgctgtgtcggcattcaaaataatcagctagtggatcacgatatcatcgaagcatta
tcgcacaagcatacgattgagccaaaaatgtaccaattgtcaaaagaactttccatctag

DBGET integrated database retrieval system