KEGG   Bradyrhizobium oligotrophicum: S58_58780Help
Entry
S58_58780         CDS       T02484                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain, RuBisCO small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:aol00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    S58_58780
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    S58_58780
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     S58_58780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6656017..6656436)
Genome map
AA seq 139 aa AA seqDB search
MRVTQGCFSFLPDLTDDQITAQIQYCLEKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMRELSECRKIYGDRYIRISAFDSSHGWESIRLSFIVNRPQNEPGFRLDRQETVGRN
QRYSTRSYAAERPEGERYS
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccaaggctgcttttccttcctgcccgacctgaccgacgatcagatcacc
gcccagatccagtactgcctggaaaagggatgggctgtgaacatcgagttcaccgacgac
ccgcacccccgcaacacctattgggagatgtggggcctgccgatgttcgacctgcgcgac
gccgccggcatcatgcgcgagctttccgagtgccggaaaatctatggcgatcgctacatc
cgcatctcggcgttcgattcctcccatggctgggagtcgatccggctgtccttcatcgtc
aaccggccgcagaacgagccgggcttccggctcgatcggcaggaaaccgtcgggcgcaat
cagcgttactccacgcgatcctacgccgccgagcgccccgagggcgagcggtactcataa

DBGET integrated database retrieval system