KEGG   Aeribacillus pallidus: AP3564_05715Help
Entry
AP3564_05715      CDS       T04993                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
apak  Aeribacillus pallidus
Brite
Translation factors [BR:apak03012]
 Eukaryotic Type
  Elongation factors
   AP3564_05715
 Prokaryotic Type
   AP3564_05715
Mitochondrial biogenesis [BR:apak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AP3564_05715
Exosome [BR:apak04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AP3564_05715
  Exosomal proteins of breast cancer cells
   AP3564_05715
  Exosomal proteins of colorectal cancer cells
   AP3564_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1191887..1193074
Genome map
AA seq 395 aa AA seqDB search
MAKAKYERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEARAYDQIDGAPEERERG
ITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIKGSALKALE
GDAEWEEKIIELMNAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGVVKVG
DEVEIVGLAEESKKTTVTGVEMFRKLLDQAEAGDNIGALLRGIARDEVERGQVLAKPGSI
TPHKKFKAQVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELISPVAIEDGTKFSIREGGRTVGAGSVSAILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatatgaacgctctaaaccacatgttaacattggtacaatcggccac
gttgaccatggtaaaactactttgactgcagctattactactgttcttgcaaaacaaggt
aaagctgaagctcgtgcatatgatcaaattgacggtgctccagaagagcgtgaacgcgga
atcacgatttcaactgcacacgtagaatacgaaactgacaaccgccactatgcacacgtt
gactgccctggacacgcagactatgttaaaaacatgatcactggtgctgctcaaatggac
ggcgctatcctagttgtttctgctgctgacggtcctatgccgcaaactcgtgagcacatt
cttttatctcgccaagtaggtgtgccttacatcgttgtattcttaaacaaatgcgacatg
gtagacgacgaagaattattagaactagttgaaatggaagttcgtgaccttctttctgaa
tatgacttccctggcgacgatgtacctgttatcaaaggttctgcgcttaaagcacttgaa
ggagatgctgaatgggaagaaaaaatcattgaattaatgaacgcagttgacgaatacatc
ccaactccagaacgcgatacagaaaaacctttcatgatgcctgttgaagacgtattctct
atcactggtcgcggtacagttgcaactggtcgtgtagaacgcggcgttgtaaaagttggt
gacgaagtagaaatcgttggtttagctgaagaatctaagaaaacaactgttactggtgtt
gaaatgttccgtaagcttcttgatcaagctgaagctggagacaacatcggtgctttactt
cgcggtatcgcacgtgacgaagtagaacgcggtcaagttttagcaaaacctggttctatc
acaccgcacaaaaaattcaaagcacaagtttacgttctttctaaagaagaaggtggacgt
catactccattcttctctaactaccgtccacaattctatttccgtactacagacgtaact
ggaattatcactcttccagaaggtgtagaaatggtaatgcctggagataacgttgaaatg
actgttgaactcatttctccagttgcgattgaagacggtacgaaattctctatccgcgaa
ggcggtcgtactgtaggtgcaggatctgtttccgctatccttgactaa

DBGET integrated database retrieval system