KEGG   Acetobacter pasteurianus 386B: APA386B_587Help
Entry
APA386B_587       CDS       T02786                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apk  Acetobacter pasteurianus 386B
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APA386B_587 (ppc)
  Energy metabolism
   00680 Methane metabolism
    APA386B_587 (ppc)
Enzymes [BR:apk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APA386B_587 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
596093..597961
Genome map
AA seq 622 aa AA seqDB search
MTMDNTSSPSRLDSILASATAHPDAGTAAEGTNPVMGIALRLGEALSREEISQTDITSLV
QKLRDEAFLARARKLHRYVGGATTEATKEKFRNVARAIAEACPSGSFAEYQARISAIQFA
AVFTAHPTFALSNPVYAALAESASQAIPPQEAPFFETHRRAAPPTLEEEFTLAAQAITRA
RDAMDLLATALLEEAATRWPQEWTSLKPCPVIATSWVGYDTDGRTDIGWWDTLRLRLRMK
LFQLMRLESQIMHEGLLAPELTEKLQRAIACVKEQISAVPAGPSDAQAVAHFAKLLVSQR
NTALTHAAELDGLLEAAINSAPPSARIPLAVARAGFVAHGLGLAHTHVRLNASQIHNFVR
QKLNLLDDPNNPAHRRALLNQINEALEAVTPVPVDFGALLSDPSSAGRLMMTIAQMVKFI
DSDTPVRFLIAETETGYTLLSALWVASCFGVADKIEISPLFETEDALMNGEHIVEEALRS
PAWRAYIRRIGRICFQFGYSDSGRYVGQLAATYLIERLRLRIHDLLVRWDMQDITVVFFD
THGESIGRGAHPFRMADRLDYLSPPHVRARFKTTGIACREETAFSGWRWLPAFWHARTGG
RYVGHHCGKPVSALTAGRRPYL
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgactatggataacacatcttctccttcccgtttggacagtatccttgcgtccgctact
gcgcacccagatgctggcacagcagctgaaggcacaaatcctgtaatgggcattgcgctc
cgacttggagaggctttgagccgcgaggaaatctcacaaacagatattacaagccttgtg
caaaagctgcgcgatgaagcctttctggcgcgcgcccgtaagctgcatcgctacgtaggt
ggcgcgacaacggaagccactaaagagaagttccgcaatgttgcacgtgcgatagccgaa
gcatgccctagtggctcttttgcagagtatcaggcacgcatctctgccattcagtttgct
gcggtctttactgcgcaccccacgtttgccctgagtaaccctgtgtatgcggctttggca
gaaagtgcatctcaagccattcccccgcaggaagcaccgttttttgaaacgcacagacgc
gctgccccacccacgctggaagaagaatttacactggccgcgcaagccataacccgtgct
cgggatgccatggatctgctggccactgccctgctggaagaagccgccacacgttggccg
caggaatggacaagcctgaagccctgcccagttattgcaaccagttgggttggctatgat
accgatggccgcacagatattggctggtgggacaccctgcgcctgcgcttgcgtatgaaa
ctgttccaactgatgcggttggaaagccagatcatgcacgagggcttgctggccccagag
ctaacagaaaagctgcaacgggctattgcctgcgtaaaagaacagattagcgccgttcct
gctggcccaagtgatgcccaggctgtagcgcattttgcaaaacttctggtttctcagcgc
aacacagcgctcacacacgcagcagaattggatggcctgcttgaggccgccatcaatagc
gcaccaccctctgcacgcattccactagcagtggcccgggcgggttttgtagcgcatggg
ctggggcttgcgcatacgcatgtgcggctcaatgcctcccagatacataacttcgttcgc
cagaagctaaacctgctggatgaccccaacaatccggcccatcgccgggcattgttgaac
cagattaacgaagcgctagaagctgtaacgcctgttcctgtagactttggagcgctgctg
agcgatccctccagtgctggacggctgatgatgaccattgcgcaaatggtcaaatttatc
gattccgatacgcctgttcgctttttgattgcagaaacagaaaccggttacacgttgctt
tcggccctgtgggtggcctcctgttttggcgtggcggataaaattgaaatctcgccgctg
tttgaaaccgaagatgcgctcatgaacggtgagcacattgtggaagaagccctgcgctct
cccgcatggcgtgcctatatccgccgtattggccgtatctgcttccagtttggatattcc
gattctggccgatatgttggccagttggcggcaacgtatctgatagaacgcctgcgcctg
cgcattcatgatctgctggtacggtgggacatgcaggatatcaccgtggtgttttttgat
acgcacggtgaaagcattggtcgcggcgcgcaccccttccgtatggcggatcggctggat
tacctttctccgccgcatgtgcgtgcacggtttaaaaccaccggcattgcctgccgtgaa
gaaacggctttttcagggtggagatggctacctgctttttggcacgccagaactggcggg
cgctacgttggccaccattgcggaaaacctgtttctgcccttacggcaggaagaagaccc
tatttatga

DBGET integrated database retrieval system