KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0004Help
Entry
APL_0004          CDS       T00476                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Brite
Enzymes [BR:apl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     APL_0004 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(4139..4711)
Genome map
AA seq 190 aa AA seqDB search
MKLTNLALAFTLFGASAVAFAHADHDHKKADNSSVEKLVVQVQQLDPVKGNKDVGTVEIT
ESAYGLVFTPHLHGLAQGLHGFHIHQNPSCEPKEKDGKLVAGLGAGGHWDPKETKQHGYP
WSDNAHLGDLPALFVEHDGSATNPVLAPRLKKLDEVKGHSLMIHEGGDNHSDHPAPLGGG
GPRMACGVIK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcacaaatctagctcttgcttttacattattcggcgcatcggcagttgccttt
gcacatgcggatcatgatcataaaaaagcggataacagctcagtggaaaaacttgtcgta
caagtacaacaacttgatcctgtaaaaggaaacaaggatgtcggtacggtagaaattacc
gaatctgcatacggtttagtgtttactccgcacttacacggtttagctcaaggtttacac
ggcttccatattcaccaaaacccaagctgtgagccgaaagaaaaagacggtaaactggtt
gccggtttaggcgctggcggtcactgggatccgaaagagaccaaacaacacggttatccg
tggtctgataacgcacacttaggcgatttaccggcattattcgtagagcatgacggttct
gcaactaaccctgttcttgcgccacgtttgaaaaaactggatgaagttaaaggtcactct
ttaatgattcacgaaggtggcgataaccactctgatcacccggctccattaggcggtggc
ggtccgcgtatggcttgcggcgtcatcaaatag

DBGET integrated database retrieval system