KEGG   Actinobacillus pleuropneumoniae L20 (serotype 5b): APL_0339Help
Entry
APL_0339          CDS       T00476                                 

Gene name
pepC
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
apl  Actinobacillus pleuropneumoniae L20 (serotype 5b)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:apl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APL_0339 (pepC)
  Energy metabolism
   00680 Methane metabolism
    APL_0339 (pepC)
Enzymes [BR:apl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APL_0339 (pepC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(373967..376606)
Genome map
AA seq 879 aa AA seqDB search
MNQPYSAMRNNIHMLGDFLGETIREAQGNEILELIESIRVLSRDSRAGDEKAREQLLDKL
ANISTENVLPVARAFSQFLNLTNIAEQYQTISRHHQDESLGNRSLSALFARLKAQGTPVE
TVIKTVEKLSIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEHDDLTEAEQTKLKRRLMQ
LIALAWHTNEIRAARPTPVDEAKWGMAIIENSLWKAVPDFCRELNFQLEKHFDVQYEVAL
SPVRFSSWMGGDRDGNPFVTAEITQKVLRMNRWKAAELFLNDVSDLVEELSIVQCTPEFR
EKYGDHIEPYRVVVKGLRSKLQKTLTYFGELIEAKPTTVDPSEIITCDNDLWEPLYDCYQ
SLHACGMRIIANGSLLDCLRRIRCFGLGLSRLDIRQESSRHETAIAEITRYIGLGDYAQW
TEDDKQAFLVRELSSRRPLVPTNWTPSPETQEILDTCKVVAQQPEGTISAYVISMAREAS
DVLAVHLLLKEAGCNYTLPVAPLFETLDDLDHSEKVMTDLFNIGWYRGVINNYQMVMIGY
SDSAKDAGMLAASWAQYRAQEALVNLAEKYHIELVLFHGRGGTVGRGGAPAHAALLSQPP
RSLKSGLRVTEQGEMIRFKLGLPAVAVETLNLYASAILEANLLPPPEPKQKWRDIMDKGA
AISCEIYRGVVRGEPDFVPYFRSATPEQELGKLPLGSRPSKRNPNGGVESLRAIPWIFAW
MQNRLMLPAWLGAGAALRQMIEQGEESTLKEMCNEWPFFSTRIGMLEMVFSKADLWLAEH
YDQRLVAKELHRLGKTLRAQLSADIQTVLTLAHDGQLMADLPWIAESIALRNVYTDPLNL
LQVELLQRLRSQGEVRDPQLEQALMITITGIAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaccctactccgctatgcgtaacaacatccatatgcttggtgattttttaggc
gaaaccattcgagaagcccaaggcaacgaaatattggaattaattgaaagcatccgagta
ctttcaagagattctcgtgcaggcgatgaaaaagcccgtgaacaattactggataaactc
gccaatatttccaccgaaaatgttttacccgttgcacgcgcattcagtcaattcttaaat
ctcaccaatattgccgaacaatatcaaaccatctctcgtcatcatcaggacgaatctctc
ggcaatcgttcattaagtgctttatttgctcgtctaaaagcacaaggcacaccggttgaa
accgtcatcaaaaccgttgagaagttatcaatcgaattagtcttaaccgctcacccgacc
gaagtaactcgccgttcgttagtacataaacacgttgaaatcaataaatgtttagggcaa
ttggaacacgacgatttaaccgaggcggagcaaaccaaacttaaacgccgtttaatgcag
ctgattgcgcttgcatggcataccaatgaaatccgtgcggcacgtccgacgccggtggat
gaagcgaaatggggaatggcgattattgaaaacagcttatggaaagccgtacctgatttt
tgccgtgaactgaactttcaattagaaaaacattttgacgtacagtatgaagtcgcactt
tcgccggtacgcttttcttcttggatgggcggcgaccgtgacggcaacccgtttgtgact
gccgaaatcacacaaaaagtattaagaatgaaccgttggaaagcagcggaattattttta
aacgatgttagcgacttggtcgaagaactttctatcgtacagtgtacgcccgaatttcgt
gagaaatacggcgatcatatcgagccgtatcgcgttgtggttaaaggtttacgtagcaaa
ttacaaaaaactttaacttacttcggcgaattgattgaagcgaaaccgaccactgttgat
ccgagcgaaattatcacttgcgataatgatttatgggaaccgctctatgattgctatcaa
tcgttgcacgcttgcggtatgcgtattatcgctaacggtagtctgttggactgcttacgc
cgtattcgttgcttcggcttaggtttatctcgtttggatattcgtcaagaaagctcccgc
cacgaaacggcaattgccgaaatcactcgctatatcggcttaggcgattacgcacaatgg
acggaagacgataaacaagcgtttttagtgcgtgaactaagttctcgtcgtccgttagta
ccgaccaactggacgccaagtcctgaaacccaagaaattttagacacttgcaaagtggta
gcccaacaacctgaagggacgatttccgcttatgtgatttctatggcacgcgaagcttcc
gacgtattagcggtacatttattattaaaagaagccggttgcaattataccctaccggtc
gcaccgttatttgaaacgttggacgacttggatcatagtgaaaaagtgatgaccgattta
tttaatatcggttggtatcgcggtgtgatcaacaattatcaaatggtgatgatcggttat
tccgattcggctaaagacgccggtatgcttgccgccagctgggcgcaatatcgcgcgcaa
gaagcattggttaatttagcggaaaaatatcatattgaactcgttttattccacgggcgc
ggcggtacggtcggtcgcggcggtgcgccggcacacgcggcattactatcacaaccgcct
cgctcgctaaaatccggtttacgcgtcaccgaacaaggcgagatgatccgcttcaaactc
ggcttacccgctgttgcggtcgaaacgttaaatctctatgcaagtgcgattttagaggcc
aacttattaccgccgccggaaccgaaacaaaagtggcgagatattatggataaaggcgcg
gcaatttcttgtgaaatttatcgcggcgttgttcgcggcgaaccggattttgtcccgtat
ttccgcagtgcgaccccagaacaagaattagggaaattaccgctcggctctcgtccttca
aaacgtaatccgaacggtggtgtggaaagcctacgcgcgattccttggattttcgcttgg
atgcaaaaccgtttgatgttaccggcttggcttggtgccggcgcggcactgcgccaaatg
atcgaacaaggcgaggaaagtacgcttaaagaaatgtgtaacgaatggccgttcttctct
acccgtatcggtatgctggaaatggtgttctcgaaagcggatttatggcttgcggaacat
tacgaccaacgtttggtggcaaaagagttacaccgtttaggtaaaacgcttcgtgcgcaa
ttatcggcggacattcaaacggtattgacacttgcgcacgacggacagcttatggcggat
ttaccttggattgccgaatctatcgccttacgtaacgtctataccgacccgctcaattta
ctgcaagtagaactgctgcaacgtttacgtagccaaggtgaggtaagagatccgcaattg
gaacaagccttaatgatcacaattaccggcattgcggcgggtatgcgtaataccggttag

DBGET integrated database retrieval system