KEGG   Anas platyrhynchos (mallard): 101794107Help
Entry
101794107         CDS       T02816                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101794107 (HK1)
   00051 Fructose and mannose metabolism
    101794107 (HK1)
   00052 Galactose metabolism
    101794107 (HK1)
   00500 Starch and sucrose metabolism
    101794107 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101794107 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101794107 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101794107 (HK1)
Enzymes [BR:apla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101794107 (HK1)
Membrane trafficking [BR:apla04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101794107 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 925 aa AA seqDB search
MARGALAMATWKEPNALDVPGYCCSPLCPIDKYLYAMRLSDETLIDIMARFRREMKNGLS
RDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIY
NTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGVLITWT
KRFKASGVEGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGT
GTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQL
FEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKA
KEILTRLGVEPSHEDCVAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGV
DGSLYKMHPQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAAARXXXEQHRLIDE
TLAEFKLTHEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALD
LGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIK
GARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVV
AVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVDGEQGRMCVNMEWGAF
GDNGCLDDIRTIYDKAVDDFSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQI
SETLKTRHIFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSKRAAQ
LCGAGMAAVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLL
SEDGSGKGAALITAVGCRLRDAEQN
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaggtgctctcgctatggctacatggaaggagccgaatgccctggatgtgcct
ggctactgctgctccccgctgtgcccaattgataaatacctttacgccatgcggctctcc
gacgaaacgctgattgacattatggctcgcttcaggagggagatgaagaacggcctctcc
cgagacttcaaccccacggccacggtgaaaatgcttcccactttcgtgaggtccatccct
gacggctcagagaaaggagatttcattgctctggatcttggtggttcttactttcgcatt
ctgcgggtgaaagtgtcgcacgaaaagaagcagacggtacaaatggaaagcgaaatctat
aacacacctgaagatatcatgcacggcagcgggacacggctttttgatcatgttgctgaa
tgcctgggagacttcatggagaaacaacaaatcaaagacaagaagttacccgttgggttt
acgttctctttcccgtgccgacaatccaagctagatgagggtgttctgataacctggacg
aagcgcttcaaagcaagcggagtggagggagcagacgttgtgaagctgcttaacaaggcc
atcaagaaacgtggggactacgatgcagacatcatggctgttgtgaacgatactgtcggg
acgatgatgacctgcggcttcgatgaccagcgttgtgaagttggcttgatcattggcact
ggcaccaacgcctgttacatggaggagatgcggcacatagacctggtggaaggggacgag
ggcaggatgtgcattaacacggagtggggggccttcggagatgacggttcactagaggac
atcaggaccgagttcgacagagagatcgaccgcggatccctaaatcctgggaagcagctg
tttgagaagatggtcagcgggctgtacatgggggagctggtgaggctcatcctggtgaag
atggccaaggaggggctgctctttgaagggagaatcacccccgagcttctcaccaaaggg
aagtttgagacaaagcatgtttctgccatagaaaagagcaaagaaggtttgaacaaagcc
aaagaaatcctaacccgcctgggggtggagccgtcccacgaggactgtgtggcggtccag
cacgtctgcaccatcgtgtccttccgctcggccaacctggtggcctccacgctgggcgcc
atcctcaaccagctgcgagacaacaagggggtcggccgcctccgcaccaccgtgggggtc
gatggctccctctacaagatgcacccacagtacgctcggcgcttgcacaaaaccacccgg
cgcctggtgcccgactcggacgtgcggttcctgctgtcagagagcggcagcgggaagggg
gcagcgatggtgacggcggcggcgcggcnnnnnnnngagcagcaccggctgatcgacgag
acgctggctgagttcaagctcacccacgagcagctgctgcaggtgaagaagaggatgagg
acggagatggaagcgggcctgaagaagaagagtcacgagactgccaaagtgaagatgctg
cccaccttcgtccgcagcacgccggatgggacagagaacggtgactttctggcacttgac
cttggagggacaaactttagagttttgctggtgaaaattcgcagtggtaaaaggagaaca
gtagaaatgcacaacaagatctatgcaattcctatagaggtgatgcagggaacgggagaa
gagctgtttgatcacatcgttacctgcatttctgacttcctggattatatgggaataaaa
ggtgcacggcttcctctcggcttcacgttttccttcccttgcaagcagaccagtctagat
gctggtatcctcctcaactggacaaaaggcttcaaggctacagactgtgagggagaagac
gtggtgtatttgcttagagaaggaattaaaagaagagaggagtttgacttagatgtggtg
gctgtggtgaacgatacggtgggcacgatgatgacttgtgcttatgaagacccaaactgt
gaaattggactcattgtgggaactggcagcaacgcctgctacatggaagagatgagaaac
gtagagatggtggatggtgagcaaggacggatgtgtgtgaacatggagtggggagcgttc
ggggataatggatgcctggacgatatcaggacgatatatgacaaagcggttgatgacttt
tcactaaatgctggaaagcaaaggtatgagaaaatgatcagtgggatgtacctgggggaa
atagtccgcaatattctgatcgacttcaccaagcgggggttcctgttcagaggccagatt
tcagagacgttgaagaccaggcatatctttgaaaccaagttcctttcacagatcgagagc
gacaggttagctttgcttcaggtgcgaaccatcctccagcagctggggctcaacagcacc
tgcgacgacagcatcatcgtcaagaccgtgtgtggagcagtgtcgaagcgagcagctcag
ttgtgcggggctggcatggctgcagttgtagataaaattcgggagaacagaggattagag
cacctggagattacggttggtgtggacgggacgctgtacaagctacacccacacttttcg
aggattatgcaccaaacagtcaaagacctggcacccaagtgcgatgtgaccttcctgctt
tcggaagacggcagtgggaaaggggcagcgctcatcacggcggtgggatgcaggcttcgt
gatgccgagcagaactga

DBGET integrated database retrieval system