KEGG   Anas platyrhynchos (mallard): 101802065Help
Entry
101802065         CDS       T02816                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
apla  Anas platyrhynchos (mallard)
Brite
Enzymes [BR:apla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101802065 (ACE)
Peptidases [BR:apla01002]
 Metallo Peptidases
  Family M2
   101802065 (ACE)
Exosome [BR:apla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101802065 (ACE)
CD molecules [BR:apla04090]
 Proteins
  101802065 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 1282 aa AA seqDB search
MPVALGLLLLVLSPVGALEPGLEPPDYDATEAGAALFXXXXXXRAEIVLFKSVSASWDYY
TNLTATNGALQVEASLEEQNFTEAWGKKAKELYGNIWNNFSDTQLKKIIGSIQTLGPSNL
PLDKRQQYNTILSDMDKIYSTAKVCPTNDTCWELEPDLSDIMATSRSYKKLLYAWEGWHN
AAGNPLRAKYEEFVQLSNEAYRMDGFEDTGSYWRSWYDSASFEDDLEHLYNQLEPLYLNL
HAFVRRKLYDRYGPKYVNLKGPIPAHLLGNMWAQQWNNIYDLMVPYPEKPNLDVTSTMVE
QGWNATHMFRVSEKFFTSLGLLEMPPEFWDKSMLEKPTDGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVQYYLQYKDQPVSFRSGANPGFHEAIGDVMSLSVSTPSHL
KEIGLLSSATEDAESSINYLLKMALEKIAFLPFGYLIDQWRWNVFNGHTPPSRYNYDWWY
LRTKYQGICAPISRNESNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTGPL
HTCDIYKSTEAGAKLREVLEAGSSKSWQEILFNLTGTDKMDAGALLEYFSPVTTWLEEQN
SKTNEVLGWPEFDWRPPVPEGYPKGIDKIADEAQAKEFLAEYNRTAEEVWNAYTEASWTY
NTNITDYNKEIMLDKNLAMSKHTLEYGMRARQFDASDFQDQTVTRILKKLSVIERAALPE
DELKEYNTLLSDMETTYSVAKVCRENKTCHPLDPDLTDILAKSQDYDELLFVWKGWRDAS
GKKMRNNYKRYVELSNKAAVLNGYTDNGAYWRSLYETSTFEEDLEKLYLQLQPLYLNLHA
YVRRALYKKYGAEHINLKGPIPAHLLGNMWAQSWSNIFNLVVPYPDATKVDATPAMKEQG
WTPKMMFEESDRFFTSLGLIPMPQEFWDKSMIEKPTDGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHVQYFLQYMNQPISFRDGANPGFHEAIGDVMALSVSTPKHLHS
IKLLDQVTENEESDINYLMSVALDKIAFLPFGYLMDQWRWKVFDGRIKEDEYNQQWWNLR
LKYQGLCPPTPRSEDDFDPGAKFHIPANVPYIRYFVSFVIQFQFHQALCDAAGHTGPLHK
CDIYQSKEAGNLLGEAMKLGFSKPWPEAMQLITGQPNMSAEALMSYFQPLMTWLVKENEK
NGEVLGWPEYDWTPYKAAQSQAGSSDRTDFLGMSLNSKQASAGGWVLLALALVFVITTIF
LGVKLSSARRKAFKSSSEMELK
NT seq 3849 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtggcgctggggctgctgctgctggtgctgagcccggtgggtgccctggagccg
gggcttgagccccccgattacgatgccaccgaggcgggggctgccctcttcnnnnnnnnn
nnnnnnntaagggccgagatcgtcctcttcaagagcgtctcggccagctgggattattac
accaacctgacggccaccaacggtgccctgcaggtcgaggcatcgctggaggagcaaaac
ttcacagaggcatggggcaagaaagccaaggagctctacggcaacatctggaacaacttc
agtgacacccagctgaagaaaatcatcggctccatccagaccctggggccctccaacctg
cccctggacaagcgacagcagtacaacaccatcctgagcgacatggacaaaatctactcc
acggccaaggtgtgcccgaccaacgatacctgctgggagctggagccagacctctcggac
atcatggccacgtcccgcagctacaagaagctcctgtacgcctgggagggctggcacaac
gccgcaggaaacccactgcgtgccaagtacgaggagttcgtgcagctgagcaacgaggcg
taccggatggacggcttcgaggacacgggcagctactggcgctcctggtacgactcagcc
tccttcgaggatgacctggagcatctctacaaccagctggagccgctctacctcaacctg
catgcctttgtccggaggaaactgtacgaccgctacggccccaaatacgtcaacctgaag
ggtcccatccctgcccacctcctgggcaacatgtgggctcagcagtggaacaacatctac
gacctgatggtcccctaccctgagaagcccaacctcgatgtgacgagcaccatggtggaa
cagggctggaacgccacccacatgttccgggtctcggagaagttcttcacctccctgggg
ctgctggagatgccccctgagttttgggacaagtccatgctggagaagccgacggacggg
cgggaggtggtgtgtcacgcctcagcatgggacttctacaaccgcaaggacttcaggatc
aagcagtgcacaacggtgactatggagcagctgttcaccgtgcaccacgagatgggccac
gtgcagtactacctgcagtacaaggaccagcccgtctccttccgcagcggggccaacccc
ggcttccacgaggccatcggagatgtcatgtccctgtccgtctccacccccagccacctc
aaggaaattgggctcctcagcagcgccaccgaggacgcggagagcagcatcaactacctg
ttgaagatggccttggagaagatcgccttcctgccctttggctacctcatcgaccagtgg
cgctggaacgtgttcaatggccacacgccccccagtcgttacaactacgactggtggtat
ctgagaactaaataccagggtatttgtgctccgatttcgaggaacgaaagcaacttcgac
cctggggcaaagtaccacatccctgggaacaccccttacatcaggtactttgtgagcttc
atcctccagttccagtttcacaaggcgctgtgccaggcggccaaccacactggtccccta
cacacctgtgacatctacaagtccacagaggctggagccaaactcagggaggtgctggaa
gctgggtcttccaagtcatggcaggaaatcctgttcaacctcactggcacggataagatg
gacgctggggccctcctggagtacttcagccctgtcaccacctggctggaggagcagaac
agcaagaccaatgaggtgctgggctggccagagttcgactggcgtccccctgtccctgaa
ggctaccccaaaggcattgacaaaatagcagacgaggcacaagctaaagagttcttggcc
gagtacaacaggacggccgaggaggtgtggaacgcctacactgaggcgtcctggacctac
aacaccaacatcaccgactacaacaaggagatcatgctggataagaacttggccatgtcc
aagcacacccttgagtacgggatgagagccaggcagttcgacgcctccgacttccaggac
caaactgtcacacgcatcctcaagaagctgagcgtcatcgagagggcagccctgcctgag
gatgagctgaaggagtacaacacccttctctcagatatggagaccacatacagcgtagcc
aaggtctgcagggagaacaaaacctgtcaccccttggatcctgacctcacggacatcctg
gccaagtcacaggactatgatgagctcctctttgtctggaagggctggcgggatgcttct
gggaagaaaatgaggaacaactacaagcgatacgtggaactgagcaacaaggcagctgtg
ctcaacggctacacagacaacggggcttactggagatccctgtatgagacatccaccttc
gaggaagatctggagaagttgtacctgcagctgcagcccctgtacctcaacctgcatgcc
tatgtacgccgggccctatacaaaaagtatggagctgagcacataaacctgaagggtccc
atccctgctcacctgctaggcaacatgtgggcccagtcatggtccaacattttcaacctg
gtggtgccctacccagatgccaccaaggtggatgccaccccagccatgaaggaacagggc
tggacacccaaaatgatgtttgaagagtcggaccgtttctttacctccctgggcctcatc
cccatgccgcaggagttctgggacaaatccatgatcgagaagccgacggacgggcgggag
gtggtgtgtcacgcctcagcatgggacttctacaaccgcaaggacttcaggatcaagcag
tgcactgtggtgaacatggatgacctgatcacggtgcaccacgagatgggccacgtccag
tacttcctgcagtacatgaaccagcccatctcattccgcgatggagccaaccctggcttc
cacgaggctattggggacgttatggccttgtccgtctccacccccaaacatctgcacagc
atcaagctgctggaccaagtcacagaaaacgaagaaagtgacattaactacctgatgagc
gtcgccctggacaaaatcgccttcctgcccttcgggtacctcatggaccagtggcgctgg
aaggtgtttgatgggcgcatcaaggaggacgagtacaaccagcagtggtggaacctcagg
ctgaagtaccagggcttgtgcccaccaacaccaaggtctgaagatgactttgaccctgga
gcaaagtttcacatccctgccaatgtcccctacatcaggtactttgtcagcttcgtgatc
cagttccagttccaccaggctctctgtgacgcagctgggcacacggggcccctgcacaag
tgtgacatctaccagtccaaggaggccgggaatctcttgggggaggccatgaagctgggt
ttcagcaagccgtggcctgaagccatgcagctcatcacggggcagcccaacatgtcagca
gaggccctgatgagctacttccagcccctcatgacatggctggtgaaggagaacgagaag
aacggggaggtcctgggctggcccgaatacgactggactccttacaaggccgctcaaagc
caagctggctcctccgaccgaaccgatttcctgggcatgtccctgaacagcaaacaagcc
tcagcaggtggctgggtcctgctcgccctggcactcgtcttcgtgatcaccaccatcttc
ctgggcgtcaagttgtcctcggcaaggagaaaggccttcaaatccagctcagaaatggaa
ctaaaataa

DBGET integrated database retrieval system