KEGG   Archaeoglobus profundus: Arcpr_0546Help
Entry
Arcpr_0546        CDS       T01152                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
apo  Archaeoglobus profundus
Pathway
apo03030  DNA replication
apo03410  Base excision repair
apo03420  Nucleotide excision repair
apo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:apo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Arcpr_0546
   03410 Base excision repair
    Arcpr_0546
   03420 Nucleotide excision repair
    Arcpr_0546
   03430 Mismatch repair
    Arcpr_0546
Enzymes [BR:apo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Arcpr_0546
    6.5.1.6  DNA ligase (ATP or NAD+)
     Arcpr_0546
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Arcpr_0546
DNA replication proteins [BR:apo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Arcpr_0546
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Arcpr_0546
DNA repair and recombination proteins [BR:apo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Arcpr_0546
   NER (nucleotide excision repair)
    Other NER factors
     Arcpr_0546
   MMR (mismatch exicision repair)
    Other MMR factors
     Arcpr_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 PQQ_2 CDC37_C
Motif
Other DBs
NCBI-ProteinID: ADB57612
JGI: Arcpr_0546
UniProt: D2RH37
LinkDB All DBs
Position
463201..464868
Genome map
AA seq 555 aa AA seqDB search
MKFREFAEFCAILERVSSTLEMTGRIASFLRRIEDDDDLYNVVHFLMGRVFPPWDERELG
VGIGLVCKALENVSGVSKEKIESMIKDYGDLGLVAERLLKGRGIKSLFAEELTIKRVREI
FDEIASLEGEGSQKRKILLLTGLYGSASPIEARYLTRLILGEMRLGVGEGIMRDAIARAW
GVDAELVERAYMIVNDLGRVAIIAKNEGKEGLKNVKIQLHIPVKMMLAQVAESIEQALRE
MKTIAVEWKYDGSRVQVHYGNGKVTIYSRRLENVTKALPEIVEEIKKCVKEGVILDGEVI
AVKDGKPMPFQEVLRRFRRKHEITKAMEKIPLEAYFFDILYNDGEVIDLPLKERRKILES
VIKESKIIKIAKQVVTNKKEEIERVFKEALDAGHEGAMLKNPNSPYTPGKRGRHWLKLKE
VMETLDLVVVGGEWGEGRRSHLISSFELACLDPRTGKLLRIGQVGTGFTDEDLEELTELF
KPLIVKEEGKKVYFKPKIVFEVAYQEIQKSPKYESGFALRFPRFVRLRDDKGVEDADTID
RVRELYEKQFARAKS
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagagaatttgctgagttttgtgcgatactcgaaagagtctcttcgacactc
gagatgactggaaggattgcatctttcctaagaagaattgaggatgatgacgacctttac
aatgtagttcacttcttaatgggtagggtatttcctccttgggatgaaagggagcttggt
gtcggtattggattagtctgcaaggctcttgagaatgtcagcggtgttagtaaggagaaa
attgagagcatgattaaggattacggcgatttgggtttggtagctgaaagactgcttaag
ggaaggggaattaaaagtttgtttgctgaggaacttaccataaaaagagttagggaaatc
tttgatgaaattgcaagcttggaaggggagggaagtcaaaagagaaagattctgcttctc
acaggtttgtacggctccgcgagtccaatagaggcaaggtacctaacaaggctcattctc
ggcgagatgaggttgggggttggagagggaattatgagagatgcgattgcaagagcatgg
ggagtagacgctgaactcgttgagagggcatacatgatagtaaacgatctgggtagagtt
gcaatcatagctaagaatgagggtaaagaggggttaaagaacgttaagattcagctacat
atcccagttaaaatgatgctcgctcaagtcgctgagagcatagagcaggctttgagagaa
atgaagactatagctgttgagtggaagtacgacggaagtagagttcaggttcactatggt
aacggaaaggtcacaatttattccagaaggcttgaaaacgtcactaaggctttacctgaa
atagttgaggagataaagaagtgcgttaaggagggagtcatactcgatggtgaagttata
gcggttaaagatggcaaacctatgcccttccaagaggtcttgagaaggtttaggagaaag
catgagataaccaaagcaatggaaaagattcctctagaagcttacttcttcgacatactg
tacaacgacggagaagtaatagatttaccgttgaaggagaggagaaagatactggagtcc
gtcataaaggaatcgaagatcataaagatcgctaagcaagtcgttacgaataagaaggaa
gagatagagcgagttttcaaggaggctttggatgcgggacatgaaggggctatgctgaag
aatcccaactcaccttatacacccggtaagaggggaaggcactggctcaagctgaaggaa
gttatggaaaccctcgatttggttgtcgttggaggagaatggggagagggaaggagaagt
catttgataagctccttcgaattagcatgcctagatccgaggactggaaagctcttgagg
ataggacaagttggtacgggtttcacagatgaagatttggaggagttgaccgagctattc
aaaccgcttatagtcaaggaggagggaaagaaggtctacttcaagccgaagatagtattt
gaagtagcctatcaggagattcagaagagtcccaaatacgagagcgggtttgcgctgagg
tttccaaggttcgtaaggttgagagatgataagggtgtagaggatgccgatactattgac
agggttagagagctctacgagaagcagtttgcgagggccaagagctga

DBGET integrated database retrieval system