KEGG   Accumulibacter phosphatis: CAP2UW1_1517Help
Entry
CAP2UW1_1517      CDS       T00966                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
app  Accumulibacter phosphatis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:app00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CAP2UW1_1517
  Energy metabolism
   00680 Methane metabolism
    CAP2UW1_1517
Enzymes [BR:app01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CAP2UW1_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1722395..1725151
Genome map
AA seq 918 aa AA seqDB search
MTEAFPEDKDLPLREDIRLLGRLLGDTLRAQEGEATFELVERIRVSAIRFHRDEDSGARQ
ELAAILDSLSRDQTQTVVRAFSHFSHLANIAEDQHHIRRSRAHLIAGSPPHAGSLAHALA
RARAAGCDVAQLYGFFDDASIVPVLTAHPTEVQRKSTLNGQRAIAHLLHRRDNSRLTPDE
QESLDEGLRRAVLALWQTRMLRTTRLMVLDEVANGLSYYDYTFLRELPRLYCWLEDHLAA
ADGGRPASELPGFLQLGSWMGGDRDGNPFVTAPVTRAALRLQSACALRFHLDEIHALGAE
LSLAEGLVSVSDALQSLADSSPDTAAARSDEPYRRALTGIYARLAATARKLDGLEPERHP
VGESAPYANCGEFAADLDVIHRSLVANGSQLLARGRLRTLRRAARVFGFHLAALDLRQNS
EVHERVVGELLEAASPGTNYREHDEAGRVELLLREISSTRPLASSHLAYSDETRGELEIF
RTAADAHRAFGSQAVQNYIISKTDGVSDLLEVALLLKECGLLLPQSRELAVNIVPLFETI
PDLRNCPRVMDEVLSLPAYRRLVASRGDLQEVMLGYSDSNKDGGFLTSGWELYRAEIALV
EVFARHGVKLRLFHGRGGSVGRGGGPSYQAILAQPGGAVQGRLRLTEQGEVIASKYSNPE
VGRRNLEILASAVLEATLLAAPDPAPQPEYLEAMAMLSQSAYRAYRGLVYETEGFERYFW
ESTVIAEIAHLNIGSRPASRKKTTAIEDLRAIPWVFSWAQCRLMLPGWYGFGTAVREFLA
VHPEGLEVLQRMHHEWGFFRTLLSNMDMVLAKTDLAIAARYAELVTDPALRAAIFPRLKA
EWQATIDALLAISGQQCLLEDNPLLARSIRNRFPYLDPLNHLQIELIRRLRAGNEDERVK
RAIHLTINGIAAGLRNSG
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggcttttcccgaagacaaggatctgccgctgcgcgaagacattcggctgctt
ggccgcttgttgggcgacacgctgcgcgcgcaggaaggcgaggcgaccttcgaactggtg
gaacgtatccgggtcagcgcgatccgctttcatcgcgacgaggacagcggcgccaggcag
gaactggcagcgattctcgacagcctgtcgcgcgaccagacgcagaccgtcgtgcgcgcc
ttcagccatttctcgcacctcgccaacattgccgaggatcagcatcacatccgacgctcg
cgtgcgcacctgatcgcgggctcgccaccgcacgccggcagtctggcgcatgcgctggcg
cgcgcccgcgccgccggttgcgatgtggcgcagttgtacggtttcttcgacgacgcatcg
atcgtccccgtacttacagcgcatccaaccgaagtccagcgcaagagcaccctcaacggg
cagcgtgcgatcgcccatctgctgcatcggcgcgacaacagccggctgacgcccgacgag
caggagtcgctcgacgaggggctgcggcgcgccgtgctggccctctggcagacgcgcatg
ctgcgtacgacgcggctgatggtcctcgacgaggtggccaacgggctgtcgtattacgac
tacacattccttcgcgaactgcccaggctctactgctggctggaggatcatctcgccgcg
gccgatggcggacgaccggccagcgagttgcccggctttctccagttgggcagctggatg
ggcggcgaccgcgacggcaatcccttcgtgacggcccctgtcacgcgcgcggccctgcgc
ctgcagtcggcatgtgcgctgcgtttccacctcgacgagatccacgccctgggcgccgaa
ttgtcgctcgccgagggcctggtgagcgtctcggacgctttgcagtcactggcggacagc
tcgcccgacacggccgctgcgcgcagcgacgagccctatcggcgagcgctcaccggtatc
tacgcgcgcctggcggccaccgcgcgcaagcttgacggtctcgagccggaacgtcatccg
gttggtgaatcggctccctacgcgaattgcggggagtttgccgccgacctggacgtgatc
caccgctccttggtcgccaatggctcacaactgctggcgcgtggccgcctgcgcacgttg
cgccgtgcggcccgcgtcttcggcttccacctggcggcactcgacctgcgccagaactcc
gaggtgcacgagcgagtggtcggcgaactcctggaggcggccagccccggcaccaattac
cgcgaacatgacgaggccggacgtgtcgagctgttgctgcgcgagatcagctcgacgcgg
ccgctggcctcatcccacctcgcctatagcgacgagacgcgtggcgaactggagatcttt
cgcaccgccgccgacgcccatcgcgcctttgggtctcaggccgtacagaactacatcatc
tcgaagactgatggtgtctcggacctgctcgaagtggcgctgctcctcaaggaatgcggc
ctgctgttgccgcagtcgcgagaactggcggtgaatatcgtaccgctgttcgaaaccatt
cccgacctgcgcaactgcccgcgggtcatggacgaggtgttgtccttgcctgcctaccgc
aggctggtcgccagccgcggcgatctgcaggaggtcatgctgggctattcggacagcaac
aaggacggcggcttcctgacctcgggttgggagctctaccgggcagagatagcgctggtc
gaggtgttcgcccgccacggcgtcaagctgcgcctgttccacggacgcggcggctcggtg
gggcgcggtggcggtccgagctaccaggcgatccttgcccagccgggtggcgcggttcag
ggcaggctgcgactgaccgagcagggcgaggtgattgccagcaagtactcgaatccggag
gtcggtcggcgcaacctcgagatcctggcgtcggccgtgctcgaagcgaccttgctggcg
gcacccgatccggcgccgcagccggagtacctcgaggcgatggccatgctctcgcagtcg
gcctatcgtgcctaccgtggcctggtctatgagaccgaaggcttcgaacgttacttctgg
gagtccaccgtcatcgccgagatagcgcatctgaacatcggcagccggcctgcctcgcgc
aagaagaccaccgccatcgaggatctgcgggcaataccctgggtcttcagctgggcgcag
tgccgtctcatgttgccgggttggtacggctttggcacggcggtgcgcgagtttctcgcc
gtgcatcccgagggtctggaggtgctgcagcgcatgcaccacgagtggggcttcttccgc
acactgctctccaacatggacatggtactagccaagaccgatctggcgatcgccgcccgc
tacgccgaactggtcaccgatcccgcgctgcgcgcggcgatcttcccacgcctgaaggcc
gagtggcaggcgaccatcgacgccctgctggcgatcagcgggcagcagtgtctgctcgag
gacaacccgctgctcgcccggtcgatccgcaatcgttttccctacctcgatccgttgaat
cacctgcagatcgagctgatcaggcggctgcgtgccggcaacgaggatgagcgggtgaaa
cgcgccatccacctgacgatcaacgggatcgccgccggcctgcgcaatagtggctga

DBGET integrated database retrieval system