KEGG   Amphimedon queenslandica (sponge): 100632296Help
Entry
100632296         CDS       T02284                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial-like
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100632296
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100632296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 715 aa AA seqDB search
MLAHKLKLVAGSLLAGTVGYAGWTLVSNEGGGESEAFEGRKVSEGKRTHKDLIIPTRAEQ
LNSLQGGEQYDILVIGGGVTGAGVALDAVTRGLNVALVEKDDFSSGTSSRSTKLIHGGVR
YLQKAIMGFDLEQYRLVREALHERANLLEIAPHLSRPLPIMLPIYSWWQVPYFWCGIKLY
DFVSGKKLVKSSFYVSKAKAMEEFPMLQKNRLCGALVYYDGQHNDARMNLAIALTAAREG
AKIANHVEVLSLIKEKDLVKGAHVRDTLTGKEWNIFAKVVINATGPFTDRIRHMDNPEVP
NICQPSAGVHIVVPDYYSPRTMGLLDPSTSDGRVIFFLPWEGKTIAGTTDSPTDVTHSPQ
PTEEDIRFILKEIKDYLSPDLSVRRGDVLAAWSGIRPLVSDPNSKNTQSISRNHVIEVSN
SKMVTIAGGKWTTYRAMARDTVDKAVSVGGLNDPRGCQTDGFILEGGEAWQPTSFIRLVQ
DYGIEVEVAQYLSKTYGDKAPRVAEMAQFTGRRWPVKGKRIVEEFPYIEANVLYAIKEYA
CTAIDVIARRTSLAFLDVQAAEEALPRVVEIMGKELGWSKDEKKKQISEARHFLETMGLQ
IHHEVRNVEIKLSYQEAKRYTQIFKSLDKDNDGHISIYDLKRALKDMGETVSDRELRDLI
AEVDINKNATIEEEEFLQLMSAIRTGEVANSRMAEIVRRQQQEMGLPVRRSGGGV
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgttagcacataagctaaaactggtcgccggttctttactggctggaactgtggggtat
gccgggtggacattagtttccaatgagggaggaggagagagtgaagcatttgagggtcga
aaggtgtcagaaggaaaaaggactcacaaagacctgataatacccacccgggctgaacag
ttgaatagcttgcaaggaggagagcagtatgatatattagtgataggaggtggtgtaact
ggtgctggtgtagcccttgatgctgttactagaggtttaaatgttgctttggttgagaag
gacgacttttcttcagggactagcagtcgcagtactaaactcatccatggtggtgtcaga
tacctacagaaggcaataatgggatttgacttggagcaatacagattagtcagagaagct
ttacacgaaagggctaacctcctagagatagccccccacctctctcgccctctaccaatc
atgcttcctatatacagctggtggcaggttccttatttctggtgtggtatcaagctttat
gattttgtttctggaaagaaactggtcaaatcttcattttatgtatccaaagctaaggca
atggaggagttccctatgctacagaagaatcggttgtgtggggcgctcgtctattatgat
ggtcagcacaatgatgctagaatgaatcttgcaatagcactaacagctgctagagaagga
gccaaaatagccaaccatgtagaggtcttgtccctcattaaagagaaggatctggtgaaa
ggagctcacgtgagggacacactcactggaaaggaatggaacatatttgctaaagttgta
atcaatgcaactggtccgtttaccgaccggattcgtcacatggataatccagaggttcct
aacatatgtcagccgagtgctggcgtccatatagtggtacctgattactatagtccccgt
acaatgggcctactggacccttccaccagtgatgggcgagtcatcttcttcctaccttgg
gaaggtaagactatagctggtactactgactccccaactgatgtcactcatagcccacaa
ccaaccgaagaagacatacgcttcattttaaaagaaattaaagattatcttagtcctgat
ctatctgttcgtagaggtgatgtccttgctgcctggagcggtatccggcctcttgtcagt
gatcctaactcaaagaacactcagtcaatatcacgcaatcatgtcattgaagtcagtaac
agcaagatggtcacaatagcaggaggtaagtggactacctatagagctatggcgagggac
acagttgataaagcagtttctgttggtgggttgaatgaccccagagggtgtcagacagat
gggtttatactggagggaggggaagcgtggcaaccaacctcattcattcgtcttgtccaa
gactatgggattgaagtggaggtagctcaatatttgagtaaaacatatggtgacaaagcc
ccacgtgttgcagaaatggcacagtttacaggtagacgctggcctgtgaaaggaaagagg
attgtggaagagttcccatacattgaagctaatgttctctacgctatcaaagagtatgcc
tgtactgccattgatgtcatagctagaaggactagtctagccttccttgatgtgcaggct
gcagaggaggcactgcctcgtgttgtggagataatgggaaaggagctaggctggagcaag
gacgagaaaaagaaacaaatatcagaagcgagacacttccttgaaacaatgggtcttcag
attcatcacgaggttcgtaacgttgaaataaagctctcctatcaagaagccaaacgctac
acgcaaatattcaagagccttgacaaagacaatgatggtcacatatcaatatatgacctg
aaacgagctctgaaagatatgggagagactgtatcagatcgggaactaagggacctcatt
gctgaggtagacatcaacaagaatgcaactattgaagaagaagagtttttacagctaatg
agtgctatcagaactggtgaagttgctaatagtcgtatggctgagattgttaggaggcag
caacaagaaatgggtctacccgttcggagaagtggcggaggagtatga

DBGET integrated database retrieval system