KEGG   Amphimedon queenslandica (sponge): 100638552Help
Entry
100638552         CDS       T02284                                 

Definition
(RefSeq) alpha-amylase-like
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100638552
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100638552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 528 aa AA seqDB search
MKLLLAALSLFLITAVYGHSASEWKSRVIYQLLTDRFAKDTDDSNACSDLSTYCGGTFKG
IIQKLDYIQGLGANAIWISPIPLQTDGGYHGYWQQDITQINPNFGTEQDLKDLVNACHSK
DIWVMLDVVANHVGNQNYNDWSNFAKFVPFNDQSHYHSYCLITDFTNQQQVEVCRLANLP
DLDQSNSFVRSTLKNWVQSTIQKYGFDGIRIDTTPEVPKDFWSEYSGSAGVFSIGEVFNG
DPNYVSQYQGPLNSVLSYPMYYKLSNAFQQKQTMRNIHDGVQANQKFSDSSVLGGFLDNH
DNPRFLSQNSDWNTLQNALAYNIFAESIPIIYYGTEQGFNGPKDPNNRESLWPHYNTDHP
LYKAISIMAKFRNSLGSQLYNAQQIERYVDDQFFAFSRGNVLVATTNLGSGQSFTRTITY
HPYSDGTKLVNQLDTSDTVVVNNGQFQVNINNGLPKIYYPQSTEDVPLEEAVVSGHDEEN
KTHYTIGLVTGFASLIVVIVIVTLSAAAGVWYYRRRKNHRQYNAINSD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctgttggctgctctgtctctcttcttgatcactgccgtctacggacactct
gcaagcgaatggaaaagcagggtcatatatcaattgctcactgaccgttttgctaaagac
actgatgatagcaatgcctgcagtgatttgagcacatactgtggcgggacatttaaaggg
atcatccagaaactggactacatacaaggactaggagccaatgcaatatggatatcaccc
ataccgctccagacagatggtggatatcacggatactggcagcaggacatcactcaaatt
aatcctaactttggtacagagcaagatcttaaggacctggttaatgcttgtcacagcaaa
gacatttgggtcatgcttgatgttgttgctaatcatgttggtaatcagaactacaacgat
tggtcaaattttgcaaagtttgttccattcaacgaccagtcacattatcacagttactgt
ctcataacggactttaccaatcaacagcaggttgaggtttgccgtttagcaaatttgccc
gacttggatcaaagtaacagttttgttcgttcaactcttaagaattgggtacagagcact
attcagaagtatggatttgatggtatcagaattgacactacacctgaggttccaaaagat
ttttggagtgaatattctggctcagctggtgtttttagcattggtgaggtgttcaatgga
gaccctaactatgtgtcacagtaccaaggaccacttaactcagttttgagctatccaatg
tactataagctatccaatgcctttcaacagaagcagacaatgagaaacattcatgatgga
gtgcaagctaatcagaagttcagtgattcaagtgttcttggtggatttctggataatcac
gacaatcctagattcctaagccaaaactctgattggaatacactacagaatgcattggca
tataacatatttgctgaatctattccaataatctattatggtactgaacaaggtttcaat
ggtcccaaggatcccaacaacagagaatcactgtggccgcattacaacacagaccatccc
ctgtataaagcaatatcgataatggcaaagttccgtaatagcctaggctctcagctctac
aatgctcagcagattgagagatacgttgatgaccagttctttgctttctctcgtggtaat
gtactggttgctaccactaatcttggtagtggccagtcatttactcgtactattacatac
catccttactctgacggaaccaaattagtaaatcaattggatacatcagatacagtggtt
gtcaataacggacaattccaagttaacatcaataatggcctaccaaagatttattatcct
caatccactgaagatgttcccttggaggaagcagtagtttcaggccatgatgaagagaac
aagacccattatactatcggtctagtaactgggtttgcaagtctcattgttgttattgtc
attgttactctcagtgcagctgctggtgtttggtactacaggagaaggaagaatcatcgc
caatacaatgctattaactctgattga

DBGET integrated database retrieval system