KEGG   Amphimedon queenslandica (sponge): 100639302Help
Entry
100639302         CDS       T02284                                 

Definition
(RefSeq) thymidine kinase, cytosolic-like
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100639302
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100639302
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     100639302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
MSCVSSGFSCISGALSKGQIQVILGPMFSGKTTELMRRMRRYQVANQSCLIIKYSKDDRY
DKNGVATHDKQVSSAMAATKLYELKKTVGDYGVIGIDEGQFFPDLVEFCEDMANAGKTVI
VAALDGTFQRKAFGSVLNLIPMAESVVKLKAVCMMCFNDAAFTKRLGSEKEIEVIGGADK
YMAVCRTCYQLPSVKHSLLSTETPIRGGGPSVNGRQLFDFTDDFIN
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcgtttcgtctggtttctcttgcatcagtggtgctctcagcaaggggcagata
caggtcattctgggtccaatgttttctggaaaaactacagagttaatgaggagaatgaga
cggtatcaagtagccaatcagtcctgcctcatcatcaagtactcaaaagatgatcgttac
gacaagaatggggtagcaacacacgacaaacaagtcagttctgcaatggccgctactaag
ttatacgagttgaagaagacagtcggtgactatggtgtcattggaattgatgagggacaa
ttttttcctgatcttgttgagttttgcgaagacatggcaaatgctggtaagactgtcatc
gtagcggcactagacgggacctttcaaagaaaagcatttggttcagtacttaatcttatc
ccaatggcggagtcagtagtgaagcttaaagctgtctgtatgatgtgttttaacgatgca
gcatttactaagagactgggctcagaaaaggaaattgaggtgataggaggagctgataag
tacatggctgtatgtagaacgtgttatcagctgccgtcagtgaagcactcgttattatca
acagagactcctattagaggagggggaccatccgttaatggccgacaattgtttgatttt
accgacgattttattaattga

DBGET integrated database retrieval system