KEGG   Arthrobacter sp. ERGS1 01: AL755_01530Help
Entry
AL755_01530       CDS       T04085                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:are00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AL755_01530
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AL755_01530
Enzymes [BR:are01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AL755_01530
Bacterial toxins [BR:are02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AL755_01530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed2:325612..328278
Genome map
AA seq 888 aa AA seqDB search
MKSTDTSRGWKKPGAVAVAGALTAGLLTATMAPAFAQDAAPAPSYTEQVLAQNGDNAIDP
VLGKYYRIPALADLGNGVLLASYDGRPDGGDSPSPNSIVQRRSTDGGKTWGVPTYIARGQ
MPATGQLRYGFSDPSYVVDKETGTVFNFHVYSKDVSFQAGAFGNDDADRTITSAEVSVST
DQGLTWSTDPANMPVLPPSAYAPGSAFANFAGPLVTGVVKPVGTTVAGVDNVGGVAGVFA
ASGEGIQLKYGAHKGRLIQQFTGKVKLASGATDYQAYSVFSDDHGKTWQRGAFVGTGMDE
NKTVELSNGDVMLNSRASSGGNGGRKVAISKDGGATYGPVTIDTSLTDPVNNASITRMFP
DAAQGTPDAKILLFSNANNASSRSNGTIRYSCNDGATWSAGKQFKSGAMSYSTLTALSDG
NFGLFYEGDNNTMTFGKFNAAWLDVQCGAELAATAVSGANGATVSAAVTLRNEGTTALPA
STVGVDAKAGWTFGSAAMPAVAPGDSATVNVPVTIPAYAKAGSLNLTARANFGSRSVTAV
LPVTITGGATSSIVGLDITGSATDTARNLATNPYAVGDAVPYQFTVNSLSNIASNAIPVG
GNFKPLIPADGAGNCRWSNLAVWAGYTCGTPRHIVSADELANGFFVPSTTWQVTGTGAPT
VNYTITGAEVDLVARNAALTGTAAVSWNDVDGSGLANTGDTVTTTATVVNSGNVVLTGVT
AAGLDGSAATLAPGASVVFTSTRAVTAGELATGQVSASTLTASGHNGAKAAGVELAVAAL
PLETHPPKPGSDPAVDRAKLKGQPPVDLGLNAGKYSVGDTVTLHGAPANQWGYVYLNQHG
QRFGWYLADADGTITFTVPQGTKNGNDTLVLLDADGAQVSFGTFHVTP
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccaccgacacttcacgcggatggaagaagcccggggcagtggcagtcgcgggg
gcactgaccgccggcctgctgaccgccaccatggcgccggcttttgcacaggacgccgcg
ccggcccccagctacaccgaacaggtgctggcccaaaacggcgacaacgcgatcgacccc
gtcctgggcaagtattaccgcatccctgccctggccgatctgggcaacggcgtgctgctc
gcttcctatgacggccgccccgacggcggggactcgccgtcgcccaactcgatcgtgcag
cgacgcagcaccgacggcggcaagacctggggtgtgcccacctacatcgcccgcggccaa
atgcccgcgaccggacagctgcgctacggcttcagcgaccccagctatgtggtggacaag
gagaccggcacggtcttcaacttccacgtctactccaaggacgtcagcttccaggcgggc
gccttcggcaacgacgacgccgaccgcaccatcaccagcgccgaggtctccgtctccacg
gaccagggcctgacctggtccaccgatccggccaacatgccagttctccctccgtcggct
tacgcccccgggtccgcattcgcaaactttgccgggccgctggtgaccggcgtcgtcaag
ccggtgggcaccaccgtggccggcgtcgacaacgtgggaggcgtggcgggtgtgttcgcc
gcctccggcgaaggcatccagctcaagtacggcgcccacaagggccggttgatccagcag
ttcaccggcaaggtcaagctggccagcggcgccaccgactatcaggcgtacagcgtgttc
tccgacgaccacggcaagacctggcagcgcggcgcctttgtgggtacgggcatggatgag
aacaagaccgtggagctctccaacggtgacgtcatgctcaactcccgtgccagcagcggc
ggcaacggcggccgcaaggtggccatctccaaggacggcggcgccacctacggccccgtc
acgatcgatacctccctgacggatcccgtcaacaacgcctcgatcacgcgcatgttcccg
gatgccgcccagggcacgccggatgcgaagatcctgctgttctccaacgcgaacaacgcc
tcgagccgctccaacggcaccatccgctactcctgcaacgacggcgccacctggagtgcc
ggcaagcagttcaagtccggtgccatgagctactccaccctgacggcgcttagcgacggc
aacttcggcctgttctacgagggcgacaacaacaccatgacgttcggcaagttcaacgcc
gcctggctcgacgtgcagtgcggcgccgaactcgccgccaccgcggtctccggcgccaac
ggcgccaccgtctccgctgcggtcaccctccgcaacgagggcaccacggcgctcccggcc
tccacggtgggcgtcgacgccaaggccggctggacgttcggcagtgccgccatgccggcc
gttgcgccgggcgattccgccaccgtgaacgtgcccgtcacgatccccgcctacgccaag
gcgggctccctgaacctgaccgcgcgtgccaacttcggttcacgcagcgtcaccgccgtc
ctgcccgtcaccatcaccggtggggccacaagctccatcgtcgggctcgacatcacgggc
tcggccacggacacggcccgcaacctggccaccaacccctacgccgtgggcgacgccgtc
ccctaccagttcacggtgaacagcctgagcaacattgcctccaacgccatcccggtgggc
ggcaacttcaagccgctcatcccggccgacggcgccggcaactgccgctggagcaacctg
gccgtctgggccggctacacctgcgggacccctcgccacatcgtgtccgctgacgaactc
gccaacggcttcttcgtcccgtccaccacctggcaggtcaccggtaccggagcccccacc
gtgaactacaccatcaccggtgcggaggttgacctggtggcccgcaatgccgccctgacg
ggcacggccgccgtgtcctggaacgacgtcgacggcagcggcctggccaacaccggcgac
accgtcaccaccaccgccaccgtggtgaactccggcaatgtggtcctcaccggcgtgacg
gcggcaggcctggacggctctgcagccaccctggcccccggcgcgtccgtggtgttcacc
tcgacccgggccgtgacggccggtgaacttgccacgggccaggtttcggcctccaccctc
acggcaagcggacacaatggcgccaaggccgccggcgtcgagctggccgtggcggccctg
ccgctggaaacccacccgcccaagccgggcagcgaccccgccgtcgaccgggccaagctc
aagggccagccgcccgttgacctgggcctgaacgccggcaagtacagcgtgggcgacacc
gtcacgctgcacggagccccggccaaccagtggggctacgtctacctcaaccagcacggg
cagcggtttggctggtacctggccgacgccgacggaaccatcacgttcacggtgccccag
ggcaccaagaacggcaatgacacgctcgttttgcttgatgccgacggcgcccaggtctcc
ttcgggaccttccacgtcaccccgtaa

DBGET integrated database retrieval system