KEGG   Arthrobacter sp. ERGS1 01: AL755_01645Help
Entry
AL755_01645       CDS       T04085                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:are00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    AL755_01645
Enzymes [BR:are01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AL755_01645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
unnamed2:complement(353447..354712)
Genome map
AA seq 421 aa AA seqDB search
MDQAPPSTLDACAAADAADPLRRFRDEFLLPDGVIYLDGNSLGPRPRTALGVATRVMEDE
WGTGLIRSWNTAGWFELPGRLGDKLAGLIGAGPGEVVITDTTSLNLFKALAAALRIQQAA
DPARTVIVTERDNFPTDIYMAEGIADFLNQGYSVRLVDDALPLAAALGPDVAVVALSHVN
YRTGAMWDMPGTTAKVHDAGALVVWDLAHAAGAVPVDLRDSGADFAVGCTYKYLNGGPGS
PAFIWVHAGHQDRFWQPLSGWWGHARPFAMEDSYEPVSGIGRFLCGTQPIVSMALVECGL
DVSLAAEIDAVRAKSLALTDLFISLVAARRGDHPLELITPLDHGVRGSHVSYKHPEGYAV
MAALIARGVIGDYREPHVLRFGITPLYLGFVDVWNAVDALFDVLDNRLWDAPQFRERLKV
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagctccaccctccaccctcgacgcctgcgccgccgcggatgccgccgatccg
ctgcgccgcttccgggacgagttcctgctgcccgacggcgtcatctacctggacggcaac
tccctgggaccccgcccgcgcacggcgctgggcgtggccacccgggtcatggaggacgaa
tggggcaccggcctgatccgcagctggaacaccgccggctggtttgagctgccgggcagg
cttggcgacaaactcgccgggctgatcggtgccggccccggcgaggtggtcatcaccgac
accacatcgctgaacctgttcaaggccctggccgccgccctgcgcatccagcaggccgcc
gaccccgcccgcacggtgatcgtgaccgaacgggacaactttcccaccgacatctacatg
gccgaggggatcgcggacttcctcaaccagggctactccgtgcggctcgtggacgacgcc
ctgccgctcgcggccgcgctgggacccgacgtggccgtcgtcgcactttcccatgtcaac
taccgcaccggcgccatgtgggacatgcccggcaccaccgccaaagtgcacgacgccggc
gccctggtggtgtgggacctggcgcatgcagccggtgcagtgcccgtggacctacgagac
tccggggcggacttcgccgtgggctgcacgtacaagtacctcaacggcgggcccggctcc
ccggccttcatctgggtccacgccggccaccaggaccgtttttggcagccgctgtccggt
tggtgggggcacgcgcggccctttgccatggaggattcctacgagccggtatccgggatt
ggccgtttcctgtgcggcacccagcccatcgtgtccatggcgctggtggaatgcgggctc
gacgtgagcctggccgcggaaatcgacgccgtgcgggcgaagtcgctggcactgaccgac
cttttcatctccctggtggcggcccgccgcggcgaccaccccctggagctcatcaccccg
ctggaccacggcgtccgcggcagccacgtcagctacaagcaccccgagggttatgccgtc
atggcggccctcattgcccgcggcgtcattggcgactaccgcgaaccccacgtgctccgc
tttggcatcacgccgctgtacctgggcttcgtcgacgtctggaacgccgtggacgccttg
ttcgacgtcctggacaaccgcttgtgggatgcgccgcagttccgggaacggctgaaagtc
acctag

DBGET integrated database retrieval system