KEGG   Arthrobacter sp. ERGS1 01: AL755_05380Help
Entry
AL755_05380       CDS       T04085                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
are  Arthrobacter sp. ERGS1:01
Pathway
are00020  Citrate cycle (TCA cycle)
are00480  Glutathione metabolism
are01100  Metabolic pathways
are01110  Biosynthesis of secondary metabolites
are01120  Microbial metabolism in diverse environments
are01130  Biosynthesis of antibiotics
are01200  Carbon metabolism
are01210  2-Oxocarboxylic acid metabolism
are01230  Biosynthesis of amino acids
Module
are_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:are00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AL755_05380
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AL755_05380
Enzymes [BR:are01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AL755_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALE05048
UniProt: A0A0M5KVA0
LinkDB All DBs
Position
296223..298442
Genome map
AA seq 739 aa AA seqDB search
MAKIIYTHTDEAPMLATYSLLPIVEAFASTAGVDIETRDISLSGRIISVFGDYLTEDQRI
ADALAELGALAKDPDANIIKLPNISASIPQLQAAIAELQGQGYALPDYPMDPSTDEEKDV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKNYAKANPHSMGAWSADSKTNVATMADGDFR
HNEKSVVIKADDALKIQFVAADGTVTVLKDAFPVLANEVVDGTVMRAAALDEFLAAQVAR
AKEEGILLSAHLKATMMKVSDPIIFGHVVKAYFPELFANYGDALAAAGLNPANGLAAIIN
GLGALPADVREGVEAAIKSGYENGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGADGQEHDTLAVLPDSSYAGVYQATIEDCRVHGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFEIAEPGTVQIVNGAGTVLIEHTVDTGDIWRACQVKDIPVRDWVKLAVTRARASAT
PAVFWLDETRAHDANLIGKVNEYLKDHDTEGLDIRILSPEKATAFTLDRIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLIAGGGLFETGAGGSAPKHVAQLVKENHLRWD
SLGEFLALAVSFEHLAVSKGNARAQILADTLDRATGTFLLENKSPKRKVGEIDNRGSHFH
LAKFWAQELTAQNDDAALAQAFAAVAKDLTDNEDVIIGELAAVQGSPVELGGYYHPDVTK
VAAIMRPSATLNKAIDTLS
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcatttacacccacaccgacgaagcccccatgttggcaacgtactcactc
ctgccgatcgttgaggcgttcgcctccaccgcgggtgtcgacattgaaacccgcgacatt
tcgctgtccggccgcatcatctccgtgtttggcgactacctcaccgaagaccagcgcatc
gccgacgcccttgccgaactgggcgccctggcgaaggaccccgacgccaacatcatcaag
ctgcccaacatcagcgcctccatcccgcagctgcaggccgccatcgccgaactccagggc
cagggctacgccctcccggactacccgatggacccctccacggatgaggaaaaggacgtt
cgcgcccggtacgacaagatcaagggcagcgccgtgaacccggtcctgcgcgaaggcaac
tcggaccgccgcgcacccctgtcggtcaagaattacgccaaggccaacccgcacagcatg
ggtgcctggagcgccgactccaagaccaacgtcgccaccatggccgacggcgacttccgc
cacaacgagaagtccgttgtcatcaaggccgacgacgccctcaagatccagttcgtcgcc
gccgacggcaccgtgaccgtcctcaaggacgccttcccggtcctcgcgaacgaggtcgtt
gacggtaccgtcatgcgcgccgccgccctggacgagttcctggcagcccaggtggcccgc
gccaaggaagagggcatcctgctctccgcccacctgaaggccaccatgatgaaggtctcc
gacccgatcatcttcggccacgtcgtgaaggcgtacttcccggaactgttcgccaactac
ggtgacgcactggccgccgccggcctgaaccccgcgaacggcctcgccgcaatcatcaac
ggcctcggcgcactgccggccgacgtccgcgagggcgtcgaagccgcaatcaagagcggc
tacgaaaacggccccgcactggccatggtcgattccgacaagggcatcaccaacctccac
gtcccgtccgacgtgatcgttgacgcctccatgccggccatgatccgcacctccggccac
atgtggggcgccgacggccaggaacacgacaccctggcagtgctgccggacagcagctac
gccggcgtctaccaggccacgatcgaggactgccgcgtgcacggcgccttcgacccgacc
accatgggcaccgtccccaacgtgggcctcatggcgcaggccgccgaggaatacggcagc
cacgacaagacgttcgaaatcgccgagcccggcaccgtgcagatcgtcaacggcgccggc
accgtcctgatcgaacacaccgtcgacaccggtgacatctggcgcgcctgccaggtcaag
gacatccccgtccgcgactgggtcaagctggccgtcacccgtgcccgcgcctccgccacc
ccggccgtgttctggctggacgagacccgcgcccacgacgccaacctcatcggcaaggtc
aacgagtacctcaaggaccacgacaccgagggcctggacatccgcatcctgtccccggaa
aaggccactgccttcaccctggatcgcatccgccgcggcgaggacaccatctccgtgacc
ggcaacgtgctccgcgactacctcaccgacctgttcccgatcctggaacttggcaccagc
gccaagatgctctcgatcgttccgctgatcgcgggcggcggtctgttcgagaccggcgcc
ggcggttccgcacccaagcatgtcgcgcagctggtcaaggaaaaccacctccgttgggac
agcctgggcgaattcctggccctggccgtcagcttcgaacacctcgccgtcagcaagggc
aacgcccgcgcgcagatcctggccgacacgctggaccgcgccaccggcacgttcctgttg
gaaaacaagtccccgaagcgcaaggtcggcgagatcgacaaccgcggcagccacttccac
ctggccaagttctgggcccaggaactcactgcccagaacgacgacgccgccctggcccag
gcgttcgccgcagttgccaaggacctcaccgacaacgaggacgtcatcatcggcgaactc
gccgccgtgcagggctccccggttgagctgggcggctactaccacccggacgtcacgaag
gtcgccgcgatcatgcgcccgtcggcaacgctgaacaaggccatcgacaccctgagctag

DBGET integrated database retrieval system