KEGG   Arthrobacter sp. Hiyo8: AHiyo8_21250Help
Entry
AHiyo8_21250      CDS       T04181                                 

Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
arh  Arthrobacter sp. Hiyo8
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:arh00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AHiyo8_21250
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AHiyo8_21250
Enzymes [BR:arh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AHiyo8_21250
Bacterial toxins [BR:arh02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AHiyo8_21250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1495033..1497762)
Genome map
AA seq 909 aa AA seqDB search
MNNPLLSDRVRRRPGWSRGRAVSLAAAAVLVTSTVVPAYAALDPFPSPNVPSNPPGSYAE
QVLASNGDNAIDPVLGKYYRIVALADLGDGVLLASYDGRPDGGDSPSANSIVQRRSTDSG
KTWGSPTFIARGQMGSAGVQKYGFSDPSYVVDKVTGTVFNFHVYSKNQGFAGSVLGNDDS
DPNVISSQVSVSTDRGLTWSTEPVNQPTLPVPSSYAAGSAYAGFAGPLVTSTVKPNGSTV
NGVPNVGGVVSMFASSGEGIQLKYGAHAGRLIQQFAGTIVQPDGSRQIQAYSVYSDDHGT
SWNMGKPTGTGMDENKAVELSDGRVMLNSRDSTGANPHFRKVAYSSDGGVTYSTPVAETQ
LPDPRNNGSITRMYPDAAQGSADAKKLLFSNSPTPTAGGARVDGTVRYSADDGKTWGSSR
VFKPGSMSYSTLSALSDGTFGVLYEGDSNTITFGKFDTAWLSPVAAVVVPGAVTVTNGGS
AQLSVTVTNNDSSPLPASTVSLDALQDWTSTTAQLASLDPGASATVQLTVTAPSYAKAGA
VPLTARLNVGGSSITAPVSVTVSGGSASNVVGAYIFGARNDAGRDLASHPYAVGSTVPYK
FRVYSTGNVTESVVPQSGNFQPFLPPGSGNCRFSALSVWGNYLCGTPQHTVTADEVAQGF
FVPSTVWQVTGSGAATQNYTVTGDEVDLMVRHPQVNGSVVPTFNDVDGDGFAGPGDTVTF
AYTVSNSGNVALTDLSAAAIGLSKPTLAVGESVNLTSTYTLADADIAAKQLPAITIPVSA
NNGAKLASLQLARPAVELKVKPAKPGSEPAVASQELIGANPPLDLGLGTDKYRSGQTVTV
YNVEYGQWYYVYLNKRSYRLGWFFPTQQNTLTFVLPDDVKNGMDSLVVLDTDGHQVSFGD
FQVTPFGNK
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgaataacccgctactcagtgacagggtcaggaggcggccgggatggagtcggggcaga
gccgtctccttggcagccgccgcagttctcgtgacgtcaaccgttgtgcccgcctacgcc
gcgttggatccattcccgagtcccaacgttccctccaaccctccgggaagctacgccgag
caggtcctggcttccaacggtgacaacgccatcgaccccgtgctcggcaagtattaccgg
atcgtcgcgctcgcggacttgggcgacggagtcctcctggcttcctacgatggccgtccc
gatgggggcgattcaccctcggccaactcgatcgtccagcggcgcagcaccgacagcgga
aagacgtggggcagtcccaccttcatcgcgcggggacagatgggctcagcgggcgtacag
aaatacggcttcagcgaccccagctacgtcgtggacaaagtcaccgggacggtgttcaac
ttccacgtctactcgaagaaccagggatttgcgggcagcgtgctcggcaacgacgactcc
gaccccaacgtgatcagctcgcaagtgtccgtctccaccgaccgcggactcacgtggtcc
acggaaccggtcaatcagcccaccctgcctgtgccctccagctacgcggcgggttccgcc
tacgccgggtttgcaggtccgctggtcaccagtaccgtcaagccaaacggcagcaccgtc
aacggcgtccccaatgtcggcggcgtggtcagcatgttcgcctcgtccggcgagggcatc
cagctcaagtacggagcgcacgccggacggctcatccagcagtttgccggaaccattgtc
cagcccgacgggagccgccagatccaggcgtacagcgtctactccgatgaccacggcaca
tcgtggaacatgggtaagcccaccggaacgggcatggacgagaacaaggcggtggaactc
tccgacggccgcgtcatgttgaactcgcgggacagcaccggcgccaatccgcatttccgg
aaggtggcgtattcctccgacggcggtgtcacgtacagcacgcctgttgccgagacgcag
ctccctgatccgcggaacaacggctcgatcaccaggatgtatccggacgcggctcaagga
tcggcggatgccaagaagctgctcttctcgaattcgcccactcccaccgccggcggcgcg
cgggtggacggtactgtccgctactctgccgacgacggcaagacgtggggctcctcgcgc
gtcttcaagcccggaagtatgtcctactccaccctgagtgccctttcggacgggactttc
ggcgtcctgtacgaaggtgacagcaacaccatcaccttcgggaaattcgacacggcctgg
ctgagcccggttgccgccgtcgtcgtccccggtgccgtcaccgtcacgaacggtggcagc
gcccagctcagcgtgaccgtcaccaacaacgacagttcaccgcttcccgcttcgaccgtc
agccttgatgccttgcaggattggacgtcgacgacggcgcagctcgcctccctcgatccg
ggcgcctcggcgactgtccagctgactgtcacggcgccgtcgtacgccaaggcaggtgcg
gttcccctgaccgccaggttgaacgtgggtgggtcgtcgattaccgcacccgtgtccgtg
acggtttcgggtggttccgccagcaacgtggtgggcgcctacattttcggcgcccgcaat
gacgccggacgggacctggcaagccacccgtacgccgtaggtagcacggtgccttacaag
ttccgggtgtacagcacgggcaacgtcacggaatccgttgtcccgcagtccggcaacttc
caaccgttcctgccgccaggctcgggcaactgccggttcagcgcccttagcgtgtggggc
aattacctctgcggcaccccacagcacaccgtgacggcagacgaagtggcccaggggttc
ttcgtccccagcaccgtctggcaggtgaccggtagtggggctgccacccagaactacacg
gtcacgggtgacgaggtggatctgatggtccgtcatccccaagtgaacggatcggtggtt
cccaccttcaatgatgttgacggggatgggtttgccggtccgggcgataccgtcaccttc
gcctacacggtgagcaacagcggcaatgtggcgttgacggacctttcggctgcggccatt
ggtttgtccaagccaaccctggccgtgggcgagtcggtcaacctcacctccacctacacg
ctggccgacgccgacatcgcggccaagcaactcccggcaatcaccatcccggtcagcgca
aacaacggtgccaagcttgcgtcccttcagctggccaggccagcggtcgagctgaaggtc
aagcctgcgaagcccggttcggagcctgccgtggcttcccaggaattgatcggcgcgaat
ccgccgctggacttggggctcggaacggataaataccgcagcgggcagaccgtgacggtc
tacaacgtggagtacggccagtggtactacgtctacctgaacaagcgcagctaccgattg
ggctggttcttcccgacgcaacaaaacaccctgaccttcgtgctgcccgacgacgtgaaa
aacggaatggacagcctcgttgtgctggatacggacggccatcaagtgtcgtttggagac
tttcaggtgacgcccttcgggaacaagtag

DBGET integrated database retrieval system