KEGG   Arthrobacter sp. Hiyo8: AHiyo8_41380Help
Entry
AHiyo8_41380      CDS       T04181                                 

Definition
(GenBank) DNA ligase
Organism
arh  Arthrobacter sp. Hiyo8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2967097..2968173
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVAPMLAKAVGAVPDGAMSYEPKWDGFRSIVFRDGDDVEIGSRNEKPMNRYFP
ELIEALKANLPERCVLDGEIILVGKSGDRLDFEALQQRIHPAASRVKLLSEQTPAKFVAF
DLLALGDEDFTGRPFAERRAALEQALADAAAPIHLTAATRDKGTAEQWFNQFEGAGLDGL
LAKPLDGTYQPDKRVMFKVKHQRTADCVVAGYRVHKTGDDLIGSLLLGLYDDGGRLSNVG
VVGSFSMRRRKELFDELQPLVTGFEGHPWAWAEQEEGSRTPRNAEGSRWSAGKDLSFTPL
RPELVVEVAYDHMEGERFRHTTQFVRWRPDRDPESCTYEQLEEPVKFDLSAVLDTGKP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgccagtcatgcctcctgtcgcacccatgcttgccaaggcggttggtgccgtc
ccggatggcgccatgagctacgaacccaaatgggatggtttccgctccatcgtttttcgt
gacggtgacgacgtcgaaatcggtagtcgcaacgagaagccgatgaaccggtacttcccg
gagctcatcgaggcgttgaaggcaaacctgccggaacgctgcgtcctcgacggcgagatc
atcctggtcggcaagtccggtgaccgcttggactttgaagccctccagcaacgcatccat
ccggcagccagcagggtcaagctgttgtccgagcagacgccggcgaaattcgtggccttc
gacctgctcgcccttggcgatgaggacttcacgggacggcccttcgccgaacggcgggca
gcgcttgaacaagcgctcgcagacgccgccgctcccatccacctcactgcggcaacccgg
gacaagggaactgcggagcagtggttcaaccagttcgagggcgcaggcctggacggcctg
ctcgccaagccgctggatggtacctaccaaccggacaagcgcgtgatgttcaaggtcaaa
caccagcggaccgccgactgcgtcgtggccggctaccgggttcataagacgggtgacgat
cttattggttcgctattgttggggctttatgacgacggcggcaggctttccaacgtgggc
gtggtgggatccttctcgatgcggcggcgcaaggaactgttcgacgaactccaacccctc
gtgaccgggttcgaggggcatccctgggcatgggccgagcaggaggaaggcagccggaca
ccccgcaacgccgaagggagccgctggagcgcaggaaaggacctgtcgttcacgcccctg
cggccagaactcgtggtggaagtggcttacgaccatatggaaggggaacggttcaggcac
acaacgcagttcgtgcggtggcggccggacagggatccggagtcgtgcacctatgagcag
cttgaggaacccgtgaagttcgatttgtcagcggtcctggacaccgggaaaccataa

DBGET integrated database retrieval system