KEGG   Arthrobacter sp. YN: CGK93_01640Help
Entry
CGK93_01640       CDS       T05171                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
arn  Arthrobacter sp. YN
Pathway
arn03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:arn00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CGK93_01640
Enzymes [BR:arn01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CGK93_01640
DNA repair and recombination proteins [BR:arn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CGK93_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ASN18559
UniProt: A0A221NF19
LinkDB All DBs
Position
complement(350510..353068)
Genome map
AA seq 852 aa AA seqDB search
MAGKQQERVNVEGHELTLTNLGKIIYPETGTTKAEVLEYYAAVAPFLIPAAANRPVTRKR
WVNGVGTAENPGEVFFQKNLEDSAPRWIPRAAIQHSDHANVYPMVNNLATLTWMAQIASL
EIHVPQWQVDPSGKPLRPDRFVLDLDPGPGAGLPECVEVAKLARSILQDMGMDPVPVTSG
SKGIHLYTGLDGTLKSEQVSAFAKELARALESDHPELVVSDMKKSLRHGKVLVDWSQNSG
NKTTIVPYSLRGKARPTVAAPRTWRELTSASLEHLDFLAVMKRVKTGKDHFAPISERHLP
PHGEDEKDDDGAPAGSSGTGSSPGTSRERVVTVENRLAKYVGMRDPGKTPEPFPSSSAVS
AFPLTGGSSSDQPEPGDPPPPGGIFVIQEHHARRYHLDFRLERDGVLVSWALPRGVPETP
NRNNLAVHTEDHPMDYANFAGVIPKGEYGAGTVSIWDRGDYTCEKWRDGKEVIATLTGEP
GGGLGGTKRFALINTGQNWLIHLMKEQPGRRRGGASTAKAVTPQSQPTAPQPPPNYTPML
ATSGTTADLHGDDWLYELKWDGIRAIITGTEGRIRLMSRNGNDLTATYPELTDRACWPDG
DFVADGEIVALGKGSRPDFGRLQLRMNLVKAADIQRARAAVPVQLMLFDLLYDDGTDLSG
LSFRERREKLSGFAERLPQGCPLHLSAVLDHDVEDLMASAAELGLEGVMAKKADGRYVIG
RRSRSWLKLKLEQSQEVVVGGWRPGAGARSGTFGSLLLGIPDGDKLHYVGRVGSGFKDWQ
LRDIMEVLEPRAVTESPFADIPREDAAGATWVSPELVAEVTFGEWTGPGRLRHPVWRGWR
PDKSPEDVSQPN
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaagcaacaggagcgcgtgaacgtggaaggccacgagctcaccctcaccaac
ctggggaaaatcatctacccggagaccggcaccaccaaggccgaagtgctggagtactac
gccgccgtcgctcctttcctcattcccgcggcggccaacaggccggtgacgcgcaagcgg
tgggtcaacggagtgggcacagctgagaatcccggggaggtgttcttccagaagaacctt
gaggactccgccccccggtggataccccgggccgccattcagcattcggaccacgccaac
gtttaccccatggtcaacaacctggccacgttgacgtggatggcccagatcgcctcgttg
gaaatccacgttccgcagtggcaagtggatccttcagggaagccgctccgccccgaccgc
tttgttttggacctggaccccgggcccggagcgggactgcccgagtgcgttgaggtggcc
aagctggcccgctccatcctgcaggacatgggcatggaccctgtccccgtcaccagcggc
agcaagggcatccacctctacacgggcctggatgggacccttaagtccgagcaagtgtcc
gccttcgccaaagagcttgcccgcgccctggagtccgaccaccccgagctggtggtcagc
gacatgaaaaagtccctccgccacggcaaggtgctggtggactggagccagaacagtggg
aacaaaaccaccatcgtcccctactcactccgcggcaaggcgcgccccaccgtggcggcg
ccgcgcacgtggcgtgagctgacctccgcctccttggagcacttggatttcctggccgtg
atgaagcgtgtcaagacgggcaaggaccacttcgcaccgatttccgagcggcaccttccg
ccccacggtgaggatgagaaggacgacgacggtgctcccgcaggcagttcgggcacgggc
agcagcccgggtacctcccgcgagcgggtggtgacggtggagaaccgtctcgccaagtat
gtcgggatgcgcgatccgggcaagaccccggagccgtttccgtcgtcgtcggccgtttct
gccttcccgctgaccgggggctcgtcctcggatcaaccggaaccgggcgacccgccgccg
ccgggcggcatctttgtcatccaggagcaccatgcccgccgctaccatctggatttccgg
ttggaacgcgacggcgtcctggtgtcgtgggcactcccccgtggcgttcctgaaactcca
aaccgcaacaacctggccgtgcacaccgaggaccatcccatggactatgccaacttcgcg
ggcgtcatccccaagggcgagtacggcgcggggaccgtcagcatctgggaccgcggcgat
tacacgtgcgagaaatggcgcgacggcaaggaagtcattgcgaccctcacaggcgagccg
ggcggcggacttggtgggaccaaacggttcgcgctgatcaatacgggtcagaactggctg
atccacctgatgaaggagcaacctggaaggcggcggggtggagcatccacagccaaagcc
gtgacaccccagtcccagccgacggctccgcagcccccgccgaattacacccccatgctc
gcaacctcaggcaccaccgctgacctccacggcgacgattggctgtatgaattgaagtgg
gacggaatccgggcgatcatcacgggaaccgagggcaggatccgcctcatgagccgcaac
ggaaatgacctcacggccacatacccagaactgacggaccgcgcatgctggcccgacggc
gacttcgttgctgatggcgagatcgtggcgctcggcaaaggatcacggcctgatttcggc
cggctgcaactccggatgaacctggtcaaagctgcggacatccagcgggcacgggcagcg
gtcccggtgcagctcatgctgttcgaccttctgtacgacgacggcacggacctgagcggc
ctgtctttccgagagcgtcgcgaaaaactctcggggtttgcggagcgcttgccccaaggc
tgcccgctgcatctttcggcggttctggaccatgacgtagaggatctcatggccagcgcc
gccgagctgggcttggagggcgtgatggcgaagaaagccgacggccgttatgtgatcggc
cgccgcagcaggtcctggctcaagctcaagctggagcaaagccaggaagtggtggtgggt
ggctggcgtcccggtgccggggctcgaagcgggacgttcggttccctcttgttgggcatc
ccggacggcgacaagctgcactatgtgggcagggttggcagcggattcaaggactggcaa
ctgcgggacatcatggaggttctggagccccgcgcggtgaccgaatcccccttcgcggac
atcccccgtgaggacgcggcaggtgccacgtgggtcagccctgagcttgtggcggaggtg
accttcggggaatggacggggcccggccggctgcggcatcccgtgtggcgtggctggcgc
cccgacaagtcccctgaggacgtaagccagcccaactga

DBGET integrated database retrieval system